F247560

General Info

Members Datasets Scaffolds Average Seq Length
166 120 332 239

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10000112|Ga0070658_1000011256
Length 286
Sequence MNSRLCPADRGRIAALPLRRLRRHLPLAGEDCVGTCSFQPDSPPPRVYAPAMQAIRNIVILTGAGTSAESGLATFRGPDGLWEGHRVEDVCTLEALARDPDLVLEFYDMRRRALADVRPNPAHEALARLDAEWPGELLIVTQNVDDLHERAGAKRLIHMHGELLSALCRACGARSHFEGAMRDRPLCPACGGSGGLRPDIVFFGEIPYRMDEIEAALQQADLFVSIGTSGAVYPAAGFVQLARAAGADTLELNLEPSAGTALFAESEFGAASVLVPAWVESLLAGH

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
50 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
80 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
81 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
82 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
88 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
89 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
92 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
93 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
94 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
95 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
96 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
97 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
98 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
99 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
100 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
101 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
102 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
103 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
104 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
105 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
106 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
107 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
108 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
109 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
110 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
111 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
112 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
113 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
114 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
115 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
116 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
117 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
118 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
119 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
120 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.19
Metatranscriptomes 0
Isolates 1.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.61
Nodule 0
Rhizoplane 0
Rhizosphere 89.16
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10000112 3300005327 Bacteria 72516
2 JGI24736J21556_1006284 3300001904 Bacteria 2000
3 JGI24739J22299_10000268 3300001989 Bacteria 17502
4 JGI24737J22298_10000441 3300001990 Bacteria 14198
5 JGI24737J22298_10006625 3300001990 Bacteria 3945
6 JGI24737J22298_10042746 3300001990 Bacteria 1388
7 JGI24735J21928_10001442 3300002067 Bacteria 8405
8 JGI24735J21928_10001839 3300002067 Bacteria 7443
9 JGI24735J21928_10015616 3300002067 Bacteria 2366
10 JGI24735J21928_10017075 3300002067 Bacteria 2246
11 JGI24738J21930_10000543 3300002075 Bacteria 10769
12 JGI24744J21845_10000350 3300002077 Bacteria 7810
13 rootH1_10014244 3300003316 Bacteria 2802
14 Ga0070658_10000529 3300005327 Bacteria 33129
15 Ga0070658_10003377 3300005327 Bacteria 13153
16 Ga0070658_10011425 3300005327 Bacteria 7121
17 Ga0070658_10018766 3300005327 Bacteria 5540
18 Ga0070676_10000293 3300005328 Bacteria 22238
19 Ga0070676_10026861 3300005328 Bacteria 3260
20 Ga0070683_100071010 3300005329 Bacteria 3248
21 Ga0068869_100000128 3300005334 Bacteria 36621
22 Ga0068868_100000016 3300005338 Bacteria 102357
23 Ga0070660_100000398 3300005339 Bacteria 28903
24 Ga0070660_100005241 3300005339 Bacteria 8963
25 Ga0070660_100015881 3300005339 Bacteria 5450
26 Ga0070660_100069170 3300005339 Bacteria 2753
27 Ga0070660_100123230 3300005339 Bacteria 2070
28 Ga0070675_100010996 3300005354 Bacteria 7087
29 Ga0070671_100015870 3300005355 Bacteria 6085
30 Ga0070671_100038261 3300005355 Bacteria 3981
31 Ga0070671_100538272 3300005355 Bacteria 1007
32 Ga0070673_100000018 3300005364 Bacteria 110071
33 Ga0070659_100045596 3300005366 Bacteria 3434
34 Ga0070659_100270794 3300005366 Bacteria 1411
35 Ga0070659_100452959 3300005366 Bacteria 1089
36 Ga0070678_100013641 3300005456 Bacteria 5105
37 Ga0070662_100026273 3300005457 Bacteria 4031
38 Ga0070662_100489306 3300005457 Bacteria 1025
39 Ga0068867_100000022 3300005459 Bacteria 92511
40 Ga0070698_100486787 3300005471 Bacteria 1171
41 Ga0068853_100241081 3300005539 Bacteria 1657
42 Ga0070672_100048942 3300005543 Bacteria 3287
43 Ga0070672_100062780 3300005543 Bacteria 2933
44 Ga0070693_100033525 3300005547 Bacteria 2835
45 Ga0068855_100000066 3300005563 Bacteria 125787
46 Ga0070664_100411383 3300005564 Bacteria 1238
47 Ga0068857_100122322 3300005577 Bacteria 2344
48 Ga0068854_100114497 3300005578 Bacteria 2039
49 Ga0068859_100066587 3300005617 Bacteria 3637
50 Ga0068859_100519276 3300005617 Bacteria 1286
51 Ga0068865_100000007 3300006881 Bacteria 185316
52 Ga0097620_100066586 3300006931 Bacteria 3637
53 Ga0097620_100519301 3300006931 Bacteria 1286
54 Ga0105240_10340748 3300009093 Bacteria 1703
55 Ga0105245_10001988 3300009098 Bacteria 18565
56 Ga0105243_10000361 3300009148 Bacteria 48670
57 Ga0105242_10000861 3300009176 Bacteria 23528
58 Ga0105238_10007963 3300009551 Bacteria 10603
59 Ga0105249_10006674 3300009553 Bacteria 10049
60 Ga0105239_10369572 3300010375 Bacteria 1621
61 Ga0105246_10000271 3300011119 Bacteria 26991
62 Ga0157373_10189991 3300013100 Bacteria 1447
63 Ga0157370_10000116 3300013104 Bacteria 92448
64 Ga0157370_10324459 3300013104 Bacteria 1420
65 Ga0157374_10001341 3300013296 Bacteria 20947
66 Ga0157378_10002022 3300013297 Bacteria 18141
67 Ga0157372_10163356 3300013307 Bacteria 2574
68 Ga0157372_10335267 3300013307 Bacteria 1761
69 Ga0157380_10222726 3300014326 Bacteria 1689
70 Ga0157377_10015008 3300014745 Bacteria 3951
71 Ga0157379_10698815 3300014968 Bacteria 952
72 Ga0157376_10000046 3300014969 Bacteria 109341
73 Ga0163161_10133608 3300017792 Bacteria 1873
74 Ga0209455_1001238 3300025272 Bacteria 12090
75 Ga0207647_10000316 3300025904 Bacteria 40242
76 Ga0207647_10026255 3300025904 Bacteria 3813
77 Ga0207647_10067797 3300025904 Bacteria 2161
78 Ga0207645_10000855 3300025907 Bacteria 25367
79 Ga0207645_10040979 3300025907 Bacteria 2965
80 Ga0207705_10000044 3300025909 Bacteria 180886
81 Ga0207705_10000078 3300025909 Bacteria 120247
82 Ga0207705_10008621 3300025909 Bacteria 7433
83 Ga0207705_10674061 3300025909 Bacteria 804
84 Ga0207695_10203798 3300025913 Bacteria 1891
85 Ga0207660_10625168 3300025917 Bacteria 878
86 Ga0207657_10000678 3300025919 Bacteria 36236
87 Ga0207657_10002153 3300025919 Bacteria 21338
88 Ga0207657_10065628 3300025919 Bacteria 3094
89 Ga0207657_10074211 3300025919 Bacteria 2873
90 Ga0207657_10090599 3300025919 Bacteria 2552
91 Ga0207681_10524178 3300025923 Bacteria 973
92 Ga0207694_10034822 3300025924 Bacteria 3862
93 Ga0207694_10664434 3300025924 Bacteria 878
94 Ga0207659_10018434 3300025926 Bacteria 4577
95 Ga0207687_10000483 3300025927 Bacteria 26904
96 Ga0207690_10118815 3300025932 Bacteria 1916
97 Ga0207690_10156644 3300025932 Bacteria 1694
98 Ga0207690_10413366 3300025932 Bacteria 1078
99 Ga0207706_10024677 3300025933 Bacteria 5388
100 Ga0207706_10123565 3300025933 Bacteria 2277
101 Ga0207686_10001490 3300025934 Bacteria 13200
102 Ga0207704_10000017 3300025938 Bacteria 154190
103 Ga0207691_10067656 3300025940 Bacteria 3229
104 Ga0207691_10082287 3300025940 Bacteria 2892
105 Ga0207689_10000083 3300025942 Bacteria 75987
106 Ga0207679_10433487 3300025945 Bacteria 1162
107 Ga0207667_10000137 3300025949 Bacteria 110326
108 Ga0207651_10000011 3300025960 Bacteria 191950
109 Ga0207712_10237209 3300025961 Bacteria 1467
110 Ga0207640_10064384 3300025981 Bacteria 2441
111 Ga0207677_10000158 3300026023 Bacteria 53930
112 Ga0207639_10332703 3300026041 Bacteria 1352
113 Ga0207678_10055625 3300026067 Bacteria 3408
114 Ga0207702_10069672 3300026078 Bacteria 3024
115 Ga0207648_10000047 3300026089 Bacteria 110365
116 Ga0207674_10119701 3300026116 Bacteria 2602
117 Ga0207683_10033206 3300026121 Bacteria 4482
118 Ga0265324_10031498 3300029957 Bacteria 1857
119 Ga0307413_10550576 3300031824 Bacteria 936
120 Ga0307406_10811451 3300031901 Bacteria 790
121 Ga0307407_10559175 3300031903 Bacteria 847
122 Ga0307412_10028994 3300031911 Bacteria 3470
123 Ga0307412_10180460 3300031911 Bacteria 1587
124 Ga0307412_10326890 3300031911 Bacteria 1222
125 Ga0307409_100268636 3300031995 Bacteria 1569
126 Ga0307416_100148858 3300032002 Bacteria 2143
127 Ga0307414_10058977 3300032004 Bacteria 2707
128 Ga0307411_10857984 3300032005 Bacteria 804
129 Ga0316584_0065531 3300036712 Bacteria 2721
130 Ga0395899_0182209 3300037312 Bacteria 1474
131 Ga0395900_0039448 3300037418 Bacteria 4866
132 Ga0439448_0027378 3300042005 Bacteria 1796
133 Ga0439455_0004211 3300042012 Bacteria 2832
134 Ga0466972_0035460 3300044658 Bacteria 2441
135 Ga0466965_0028572 3300044683 Bacteria 2710
136 Ga0466966_0041927 3300044684 Bacteria 2940
137 Ga0466964_0006716 3300044706 Bacteria 4290
138 Ga0466968_0024565 3300044735 Bacteria 2463
139 Ga0466970_0225562 3300044765 Bacteria 1046
140 Ga0466960_0001553 3300044901 Bacteria 8396
141 Ga0495650_0025207 3300046471 Bacteria 2793
142 Ga0495606_0000710 3300046507 Bacteria 51532
143 Ga0495663_0061605 3300046525 Bacteria 1180
144 Ga0495598_0046915 3300046537 Bacteria 1285
145 Ga0495668_0006758 3300046616 Bacteria 7456
146 Ga0495668_0026715 3300046616 Bacteria 3274
147 Ga0495671_0091693 3300046692 Bacteria 1487
148 Ga0496117_0156249 3300048920 Bacteria 1342
149 Ga0496118_0009458 3300048921 Bacteria 9839
150 Ga0496118_0019001 3300048921 Bacteria 6161
151 Ga0496118_0172914 3300048921 Bacteria 1317
152 Ga0496121_0042644 3300048924 Bacteria 3942
153 Ga0496122_0036815 3300048925 Bacteria 3949
154 Ga0496123_0035114 3300048926 Bacteria 3579
155 Ga0496125_0024095 3300048928 Bacteria 5604
156 Ga0496125_0194671 3300048928 Bacteria 1334
157 Ga0496126_0109855 3300048929 Bacteria 2403
158 Ga0501035_0105329 3300049822 Bacteria 2473
159 Ga0500643_000001 3300053087 Bacteria 1440111
160 Ga0500643_016961 3300053087 Bacteria 2451
161 Ga0500641_0008585 3300053096 Bacteria 3651
162 Ga0500577_0179075 3300053142 Bacteria 909
163 Ga0500616_0186220 3300053153 Bacteria 931
164 2643950766 2643221588 Bacteria 3692460
165 2896187335 2896184354 Bacteria 3258548
166 2896254204 2896253425 Bacteria 3418029
167 Ga0070658_10000112
168 JGI24736J21556_1006284
169 JGI24739J22299_10000268
170 JGI24737J22298_10000441
171 JGI24737J22298_10006625
172 JGI24737J22298_10042746
173 JGI24735J21928_10001442
174 JGI24735J21928_10001839
175 JGI24735J21928_10015616
176 JGI24735J21928_10017075
177 JGI24738J21930_10000543
178 JGI24744J21845_10000350
179 rootH1_10014244
180 Ga0070658_10000529
181 Ga0070658_10003377
182 Ga0070658_10011425
183 Ga0070658_10018766
184 Ga0070676_10000293
185 Ga0070676_10026861
186 Ga0070683_100071010
187 Ga0068869_100000128
188 Ga0068868_100000016
189 Ga0070660_100000398
190 Ga0070660_100005241
191 Ga0070660_100015881
192 Ga0070660_100069170
193 Ga0070660_100123230
194 Ga0070675_100010996
195 Ga0070671_100015870
196 Ga0070671_100038261
197 Ga0070671_100538272
198 Ga0070673_100000018
199 Ga0070659_100045596
200 Ga0070659_100270794
201 Ga0070659_100452959
202 Ga0070678_100013641
203 Ga0070662_100026273
204 Ga0070662_100489306
205 Ga0068867_100000022
206 Ga0070698_100486787
207 Ga0068853_100241081
208 Ga0070672_100048942
209 Ga0070672_100062780
210 Ga0070693_100033525
211 Ga0068855_100000066
212 Ga0070664_100411383
213 Ga0068857_100122322
214 Ga0068854_100114497
215 Ga0068859_100066587
216 Ga0068859_100519276
217 Ga0068865_100000007
218 Ga0097620_100066586
219 Ga0097620_100519301
220 Ga0105240_10340748
221 Ga0105245_10001988
222 Ga0105243_10000361
223 Ga0105242_10000861
224 Ga0105238_10007963
225 Ga0105249_10006674
226 Ga0105239_10369572
227 Ga0105246_10000271
228 Ga0157373_10189991
229 Ga0157370_10000116
230 Ga0157370_10324459
231 Ga0157374_10001341
232 Ga0157378_10002022
233 Ga0157372_10163356
234 Ga0157372_10335267
235 Ga0157380_10222726
236 Ga0157377_10015008
237 Ga0157379_10698815
238 Ga0157376_10000046
239 Ga0163161_10133608
240 Ga0209455_1001238
241 Ga0207647_10000316
242 Ga0207647_10026255
243 Ga0207647_10067797
244 Ga0207645_10000855
245 Ga0207645_10040979
246 Ga0207705_10000044
247 Ga0207705_10000078
248 Ga0207705_10008621
249 Ga0207705_10674061
250 Ga0207695_10203798
251 Ga0207660_10625168
252 Ga0207657_10000678
253 Ga0207657_10002153
254 Ga0207657_10065628
255 Ga0207657_10074211
256 Ga0207657_10090599
257 Ga0207681_10524178
258 Ga0207694_10034822
259 Ga0207694_10664434
260 Ga0207659_10018434
261 Ga0207687_10000483
262 Ga0207690_10118815
263 Ga0207690_10156644
264 Ga0207690_10413366
265 Ga0207706_10024677
266 Ga0207706_10123565
267 Ga0207686_10001490
268 Ga0207704_10000017
269 Ga0207691_10067656
270 Ga0207691_10082287
271 Ga0207689_10000083
272 Ga0207679_10433487
273 Ga0207667_10000137
274 Ga0207651_10000011
275 Ga0207712_10237209
276 Ga0207640_10064384
277 Ga0207677_10000158
278 Ga0207639_10332703
279 Ga0207678_10055625
280 Ga0207702_10069672
281 Ga0207648_10000047
282 Ga0207674_10119701
283 Ga0207683_10033206
284 Ga0265324_10031498
285 Ga0307413_10550576
286 Ga0307406_10811451
287 Ga0307407_10559175
288 Ga0307412_10028994
289 Ga0307412_10180460
290 Ga0307412_10326890
291 Ga0307409_100268636
292 Ga0307416_100148858
293 Ga0307414_10058977
294 Ga0307411_10857984
295 Ga0316584_0065531
296 Ga0395899_0182209
297 Ga0395900_0039448
298 Ga0439448_0027378
299 Ga0439455_0004211
300 Ga0466972_0035460
301 Ga0466965_0028572
302 Ga0466966_0041927
303 Ga0466964_0006716
304 Ga0466968_0024565
305 Ga0466970_0225562
306 Ga0466960_0001553
307 Ga0495650_0025207
308 Ga0495606_0000710
309 Ga0495663_0061605
310 Ga0495598_0046915
311 Ga0495668_0006758
312 Ga0495668_0026715
313 Ga0495671_0091693
314 Ga0496117_0156249
315 Ga0496118_0009458
316 Ga0496118_0019001
317 Ga0496118_0172914
318 Ga0496121_0042644
319 Ga0496122_0036815
320 Ga0496123_0035114
321 Ga0496125_0024095
322 Ga0496125_0194671
323 Ga0496126_0109855
324 Ga0501035_0105329
325 Ga0500643_000001
326 Ga0500643_016961
327 Ga0500641_0008585
328 Ga0500577_0179075
329 Ga0500616_0186220
330 2643950766
331 2896187335
332 2896254204

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02146

SIR2

Sir2 family

63

234

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rxl-assembly1.cif.gz_A crystal structure of cobb wt in complex with h4k16-crotonyl peptide 0.9523 3 234
6rxr-assembly1.cif.gz_A crystal structure of cobb ac2 (a76g, i131c, v162g) in complex with h4k16cr-2'oh-adpr peptide intermediate after co-crystallisation 0.9518 3 234
6rxr-assembly4.cif.gz_D crystal structure of cobb ac2 (a76g, i131c, v162g) in complex with h4k16cr-2'oh-adpr peptide intermediate after co-crystallisation 0.9455 3 234
6rxq-assembly2.cif.gz_B crystal structure of cobb ac2 (a76g,i131c,v162a) in complex with h4k16cr-2'oh-adpr peptide intermediate after soaking 0.9445 3 234
6rxm-assembly4.cif.gz_D crystal structure of cobb ac2 (a76g, i131c, v162g) in complex with h4k16-acetyl peptide 0.9433 3 235
ID Description Score Start End Superfamily
af_A4IAM7_70_238_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9738 68 232 3.40.50.1220
1s5pA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9544 3 234 3.40.50.1220
af_P75960_40_271_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9478 3 232 3.40.50.1220
af_A4IAM7_70_238_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9456 68 232 3.40.50.1220
af_Q68FX9_35_302_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9383 4 228 3.40.50.1220
ID Description Score Start End GO Terms
AF-A0A2T5FTV8-F1-model_v4 NAD-dependent protein deacylase (EC 2.3.1.286) (Regulatory protein SIR2 homolog) 0.9909 1 234 GO:0005737
GO:0008270
GO:0032041
GO:0036054
GO:0036055
GO:0046969
GO:0046970
GO:0070403
GO:0097372
GO:0140765
GO:0141222
AF-A0A3N0DIK5-F1-model_v4 NAD-dependent protein deacylase 0.9885 6 137 GO:0017136
GO:0070403
AF-A0A848SJA8-F1-model_v4 protein acetyllysine N-acetyltransferase (EC 2.3.1.286) 0.9878 1 163 GO:0017136
GO:0046872
GO:0070403
AF-A0A258Z3L3-F1-model_v4 deleted 0.9864 3 233
AF-A0A2T5FTV8-F1-model_v4 NAD-dependent protein deacylase (EC 2.3.1.286) (Regulatory protein SIR2 homolog) 0.9826 1 234 GO:0005737
GO:0008270
GO:0032041
GO:0036054
GO:0036055
GO:0046969
GO:0046970
GO:0070403
GO:0097372
GO:0140765
GO:0141222

Map