F247238

General Info

Members Datasets Scaffolds Average Seq Length
165 137 326 530

Family's Representative Sequence

Representative Sequence 3300053153|Ga0500616_0000060|Ga0500616_0000060_141429_143123
Length 557
Sequence MTPAWNRFEGALPVNTSQTPAPRRPGIGRRGFLLGTGALLGATQLARPSLASAAGTVITDGAHVPVLIIGSGYGGAVAALRLTQAGITTHVVEMGQSWTTPGSDGKIFPSVLNPDGRSYWFRTTTDQPVGYFLGINANKSITSYAGVLDSEKFAATRIYQGRGVGGGSLVNGGMAITPKKSYFAEILPSVDADQMYSTYFPRANAALGVNTIDQTWFETADCYQYARVSRTRASNAGYSTTFVPNVYDFNYMKQEQANTVPRSALASEVIYGNNYGKKSLDKTYLAAAAATGRLTISPLHTVTSVAPVASGSGYSVALTQIDTSGAVVARKTVTADRVFFAAGSVGTSKLLVSMKAQGKLPNLPSAVGTNWGNNGNVMVARAGLDLTGSLQSGMPALGIDNWADPSGPVFAEIAPFPAGTELWINLYLAITKNPNRAVFSYNSGTGKVDLNWTAGQTQPSIDAAKKVFDKINSKAGTVYRTDLFGVYKTWGDDFVYHPLGGCVLNQATDNYGRLPGYPGLYVVDGSLIPGSTGVNPFVTITALAERNLAQIVATDLS

Samples

Sample ID Description Type Environment
1 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
9 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
10 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
13 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
14 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
15 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
16 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
18 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
19 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
20 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
21 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
22 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
23 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
24 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
25 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
26 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
27 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
28 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
41 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
42 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
43 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
44 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
45 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
46 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
47 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
48 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
49 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
50 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
51 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
52 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
53 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
54 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
55 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
56 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
57 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
58 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
59 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
60 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
61 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
62 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
63 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
64 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
65 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
66 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
67 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
68 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
69 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
70 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
71 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
72 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
73 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
74 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
75 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
76 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
77 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
78 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
79 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
80 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
81 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
82 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
83 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
84 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
85 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
86 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
87 2558860280 Kutzneria sp. 744 Isolate Unclassified
88 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
89 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
90 2643221576 Nocardioides sp. Root614 Isolate Unclassified
91 2643221578 Streptomyces sp. Root63 Isolate Unclassified
92 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
93 2643221590 Nocardioides sp. Root682 Isolate Unclassified
94 2643221604 Nocardioides sp. Root190 Isolate Unclassified
95 2643221617 Nocardioides sp. Root79 Isolate Unclassified
96 2643221620 Nocardioides sp. Root240 Isolate Unclassified
97 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
98 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
99 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
100 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
101 2738541305 Nocardioides sp. CF167 Isolate Unclassified
102 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
103 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
104 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
105 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
106 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
107 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
108 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
109 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
110 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
111 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
112 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
113 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
114 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
115 2862574272 Streptomyces sp. AcE210 Isolate Nodule
116 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
117 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
118 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
119 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
120 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
121 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
122 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
123 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
124 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
125 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
126 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
127 2922554459 Rhodococcus sp. 66b Isolate Unclassified
128 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
129 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
130 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
131 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
132 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
133 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
134 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
135 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
136 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
137 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 65.45
Metatranscriptomes 1.82
Isolates 32.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.85
Nodule 0.61
Rhizoplane 1.21
Rhizosphere 58.79
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500616_0000060 3300053153 Bacteria 252252
2 JGI25406J46586_10000332 3300003203 Bacteria 21310
3 rootH1_10114648 3300003316 Bacteria 4598
4 rootH1_10016164 3300003323 Bacteria 3897
5 Ga0006562J51391_1246357 3300003578 Bacteria 60288
6 Ga0006562J51391_1246358 3300003578 Bacteria 60288
7 Ga0070668_100000989 3300005347 Bacteria 19947
8 Ga0070668_100090302 3300005347 Bacteria 2413
9 Ga0070710_10000172 3300005437 Bacteria 29634
10 Ga0070663_100029928 3300005455 Bacteria 3726
11 Ga0068853_100019925 3300005539 Bacteria 5571
12 Ga0068853_100030423 3300005539 Bacteria 4560
13 Ga0070665_100038872 3300005548 Bacteria 4784
14 Ga0068855_100010663 3300005563 Bacteria 11085
15 Ga0068852_100091976 3300005616 Bacteria 2716
16 Ga0068861_100081486 3300005719 Bacteria 2534
17 Ga0068863_100034946 3300005841 Bacteria 4787
18 Ga0081540_1019160 3300005983 Bacteria 4171
19 Ga0081539_10000126 3300005985 Bacteria 180324
20 Ga0075363_100013531 3300006048 Bacteria 3958
21 Ga0105251_10017506 3300009011 Bacteria 3839
22 Ga0105240_10008450 3300009093 Bacteria 14727
23 Ga0105243_10000274 3300009148 Bacteria 57534
24 Ga0105241_10006027 3300009174 Bacteria 8944
25 Ga0105238_10006551 3300009551 Bacteria 11596
26 Ga0105238_10048175 3300009551 Bacteria 4295
27 Ga0105239_10014358 3300010375 Bacteria 8787
28 Ga0157374_10033193 3300013296 Bacteria 4708
29 Ga0157378_10091429 3300013297 Bacteria 2767
30 Ga0157379_10090954 3300014968 Bacteria 2738
31 Ga0224712_10003805 3300022467 Bacteria 3982
32 Ga0207692_10000228 3300025898 Bacteria 19007
33 Ga0207647_10018794 3300025904 Bacteria 4662
34 Ga0207654_10069669 3300025911 Bacteria 2085
35 Ga0207695_10011141 3300025913 Bacteria 10911
36 Ga0207671_10005478 3300025914 Bacteria 11683
37 Ga0207694_10004167 3300025924 Bacteria 11350
38 Ga0207709_10001156 3300025935 Bacteria 19212
39 Ga0207667_10091252 3300025949 Bacteria 3147
40 Ga0207668_10004305 3300025972 Bacteria 8359
41 Ga0207668_10008437 3300025972 Bacteria 6140
42 Ga0207639_10091014 3300026041 Bacteria 2441
43 Ga0207678_10000268 3300026067 Bacteria 47323
44 Ga0268266_10050583 3300028379 Bacteria 3566
45 Ga0307515_10030692 3300028794 Bacteria 9007
46 Ga0307515_10096595 3300028794 Bacteria 3622
47 Ga0265338_10006846 3300028800 Bacteria 14358
48 Ga0307511_10000171 3300030521 Bacteria 63672
49 Ga0307512_10007881 3300030522 Bacteria 10473
50 Ga0307512_10031555 3300030522 Bacteria 4585
51 Ga0307512_10044316 3300030522 Bacteria 3658
52 Ga0265340_10000630 3300031247 Bacteria 19761
53 Ga0307513_10000202 3300031456 Bacteria 85897
54 Ga0307509_10007990 3300031507 Bacteria 13634
55 Ga0307508_10002491 3300031616 Bacteria 19419
56 Ga0307508_10104947 3300031616 Bacteria 2423
57 Ga0307516_10019224 3300031730 Bacteria 7078
58 Ga0307516_10024960 3300031730 Bacteria 6094
59 Ga0307518_10000430 3300031838 Bacteria 32130
60 Ga0307416_100137628 3300032002 Bacteria 2213
61 Ga0307411_10010779 3300032005 Bacteria 4893
62 Ga0307507_10043498 3300033179 Bacteria 4456
63 Ga0307507_10047658 3300033179 Bacteria 4180
64 Ga0373940_0000492 3300035088 Bacteria 6147
65 Ga0373942_0000678 3300035207 Bacteria 9503
66 Ga0373935_0004982 3300035692 Bacteria 7814
67 Ga0451795_0305749 3300041456 Bacteria 2132
68 Ga0451853_3290699 3300041512 Bacteria 1951
69 Ga0466965_0002764 3300044683 Bacteria 7537
70 Ga0466965_0004136 3300044683 Bacteria 6451
71 Ga0466965_0007185 3300044683 Bacteria 5102
72 Ga0466961_0016233 3300044693 Bacteria 4782
73 Ga0466961_0050320 3300044693 Bacteria 2661
74 Ga0466970_0017815 3300044765 Bacteria 3672
75 Ga0466960_0008263 3300044901 Bacteria 4257
76 Ga0495592_0067187 3300046454 Bacteria 2621
77 Ga0495603_0006433 3300046455 Bacteria 7034
78 Ga0495603_0020858 3300046455 Bacteria 3967
79 Ga0495603_0021412 3300046455 Bacteria 3915
80 Ga0495629_0000464 3300046459 Bacteria 33947
81 Ga0495629_0083559 3300046459 Bacteria 2228
82 Ga0495638_0035405 3300046460 Bacteria 3183
83 Ga0495651_0042139 3300046462 Bacteria 3545
84 Ga0495605_0033184 3300046474 Bacteria 2623
85 Ga0495585_0054407 3300046492 Bacteria 2213
86 Ga0495594_0001149 3300046499 Bacteria 13828
87 Ga0495594_0058005 3300046499 Bacteria 2138
88 Ga0495652_0004362 3300046529 Bacteria 13539
89 Ga0495645_0008648 3300046543 Bacteria 7110
90 Ga0495668_0032373 3300046616 Bacteria 2942
91 Ga0495588_0005808 3300046674 Bacteria 5521
92 Ga0495588_0031396 3300046674 Bacteria 2673
93 Ga0495657_0010059 3300046675 Bacteria 7131
94 Ga0495613_0005017 3300046689 Bacteria 9941
95 Ga0495613_0018787 3300046689 Bacteria 5151
96 Ga0495600_0062308 3300046809 Bacteria 2437
97 Ga0495636_0019101 3300047318 Bacteria 2752
98 Ga0495676_0022798 3300047321 Bacteria 5441
99 Ga0495676_0105256 3300047321 Bacteria 2080
100 Ga0495687_006521 3300047443 Bacteria 7130
101 Ga0495675_0016736 3300047444 Bacteria 4636
102 Ga0496109_0052913 3300048912 Bacteria 3702
103 Ga0496125_0029100 3300048928 Bacteria 4972
104 nmdc:mga00v17_95527_c1 3300050491 Bacteria 1871
105 Ga0500646_0000215 3300053090 Bacteria 17326
106 Ga0500641_0002901 3300053096 Bacteria 6080
107 Ga0500641_0039490 3300053096 Bacteria 1902
108 Ga0500577_0003868 3300053142 Bacteria 3912
109 Ga0500616_0003435 3300053153 Bacteria 12099
110 2559424041 2558860280 Bacteria 11429938
111 2566996148 2565956761 Bacteria 6601618
112 2586060962 2585427649 Bacteria 9053857
113 2643889373 2643221576 Bacteria 5214352
114 2643901077 2643221578 Bacteria 9213798
115 2643947101 2643221587 Bacteria 7586415
116 2643958428 2643221590 Bacteria 5214697
117 2644036340 2643221604 Bacteria 5014917
118 2644099234 2643221617 Bacteria 5139111
119 2644115115 2643221620 Bacteria 5134593
120 2644407221 2643221673 Bacteria 9196637
121 2644433428 2643221677 Bacteria 7584031
122 2644441389 2643221678 Bacteria 9540101
123 2676491424 2675903060 Bacteria 10051191
124 2738867733 2738541305 Bacteria 4910150
125 2738888754 2738541308 Bacteria 7020677
126 2739206060 2738543005 Bacteria 5278128
127 2739237855 2738543011 Bacteria 5731169
128 2739237856 2738543011 Bacteria 5731169
129 2753265828 2751185782 Bacteria 11227053
130 2774396618 2773857762 Bacteria 5971770
131 2791912039 2791354901 Bacteria 8322202
132 2808846443 2808606359 Bacteria 9866990
133 2809198282 2808606439 Bacteria 5952208
134 2809590020 2808606522 Bacteria 9488490
135 2811842720 2808606982 Bacteria 7791042
136 2812331996 2811994874 Bacteria 5367947
137 2812349461 2811994878 Bacteria 5992952
138 2862185832 2862178590 Bacteria 8583590
139 2862574701 2862574272 Bacteria 10567477
140 2866612117 2866612099 Bacteria 7543886
141 2873152781 2873151551 Bacteria 8625867
142 2875398300 2875391855 Bacteria 7600475
143 2889303630 2889300758 Bacteria 5690814
144 2889303631 2889300758 Bacteria 5690814
145 2891969326 2891968417 Bacteria 5821697
146 2895428424 2895427314 Bacteria 13147766
147 2904540783 2904535858 Bacteria 6308016
148 2912715401 2912715099 Bacteria 9460473
149 2915770482 2915768154 Bacteria 8424322
150 2918501728 2918501144 Bacteria 8668083
151 2919473358 2919468124 Bacteria 9133025
152 2922554874 2922554459 Bacteria 6683962
153 2928143834 2928142448 Bacteria 5288925
154 2935393041 2935390628 Bacteria 7043367
155 2939747414 2939743619 Bacteria 5762299
156 2939747415 2939743619 Bacteria 5762299
157 2946045974 2946045630 Bacteria 8527308
158 3003006335 3002998708 Bacteria 11715108
159 3006491105 3006486233 Bacteria 8157040
160 8003317149 8003314358 Bacteria 10575343
161 8047711075 8047710418 Bacteria 11023148
162 8055068258 8055066027 Bacteria 9479577
163 8055173980 8055172936 Bacteria 9305943
164 Ga0500616_0000060
165 JGI25406J46586_10000332
166 rootH1_10114648
167 rootH1_10016164
168 Ga0006562J51391_1246357
169 Ga0006562J51391_1246358
170 Ga0070668_100000989
171 Ga0070668_100090302
172 Ga0070710_10000172
173 Ga0070663_100029928
174 Ga0068853_100019925
175 Ga0068853_100030423
176 Ga0070665_100038872
177 Ga0068855_100010663
178 Ga0068852_100091976
179 Ga0068861_100081486
180 Ga0068863_100034946
181 Ga0081540_1019160
182 Ga0081539_10000126
183 Ga0075363_100013531
184 Ga0105251_10017506
185 Ga0105240_10008450
186 Ga0105243_10000274
187 Ga0105241_10006027
188 Ga0105238_10006551
189 Ga0105238_10048175
190 Ga0105239_10014358
191 Ga0157374_10033193
192 Ga0157378_10091429
193 Ga0157379_10090954
194 Ga0224712_10003805
195 Ga0207692_10000228
196 Ga0207647_10018794
197 Ga0207654_10069669
198 Ga0207695_10011141
199 Ga0207671_10005478
200 Ga0207694_10004167
201 Ga0207709_10001156
202 Ga0207667_10091252
203 Ga0207668_10004305
204 Ga0207668_10008437
205 Ga0207639_10091014
206 Ga0207678_10000268
207 Ga0268266_10050583
208 Ga0307515_10030692
209 Ga0307515_10096595
210 Ga0265338_10006846
211 Ga0307511_10000171
212 Ga0307512_10007881
213 Ga0307512_10031555
214 Ga0307512_10044316
215 Ga0265340_10000630
216 Ga0307513_10000202
217 Ga0307509_10007990
218 Ga0307508_10002491
219 Ga0307508_10104947
220 Ga0307516_10019224
221 Ga0307516_10024960
222 Ga0307518_10000430
223 Ga0307416_100137628
224 Ga0307411_10010779
225 Ga0307507_10043498
226 Ga0307507_10047658
227 Ga0373940_0000492
228 Ga0373942_0000678
229 Ga0373935_0004982
230 Ga0451795_0305749
231 Ga0451853_3290699
232 Ga0466965_0002764
233 Ga0466965_0004136
234 Ga0466965_0007185
235 Ga0466961_0016233
236 Ga0466961_0050320
237 Ga0466970_0017815
238 Ga0466960_0008263
239 Ga0495592_0067187
240 Ga0495603_0006433
241 Ga0495603_0020858
242 Ga0495603_0021412
243 Ga0495629_0000464
244 Ga0495629_0083559
245 Ga0495638_0035405
246 Ga0495651_0042139
247 Ga0495605_0033184
248 Ga0495585_0054407
249 Ga0495594_0001149
250 Ga0495594_0058005
251 Ga0495652_0004362
252 Ga0495645_0008648
253 Ga0495668_0032373
254 Ga0495588_0005808
255 Ga0495588_0031396
256 Ga0495657_0010059
257 Ga0495613_0005017
258 Ga0495613_0018787
259 Ga0495600_0062308
260 Ga0495636_0019101
261 Ga0495676_0022798
262 Ga0495676_0105256
263 Ga0495687_006521
264 Ga0495675_0016736
265 Ga0496109_0052913
266 Ga0496125_0029100
267 nmdc:mga00v17_95527_c1
268 Ga0500646_0000215
269 Ga0500641_0002901
270 Ga0500641_0039490
271 Ga0500577_0003868
272 Ga0500616_0003435
273 2559424041
274 2566996148
275 2586060962
276 2643889373
277 2643901077
278 2643947101
279 2643958428
280 2644036340
281 2644099234
282 2644115115
283 2644407221
284 2644433428
285 2644441389
286 2676491424
287 2738867733
288 2738888754
289 2739206060
290 2739237855
291 2739237856
292 2753265828
293 2774396618
294 2791912039
295 2808846443
296 2809198282
297 2809590020
298 2811842720
299 2812331996
300 2812349461
301 2862185832
302 2862574701
303 2866612117
304 2873152781
305 2875398300
306 2889303630
307 2889303631
308 2891969326
309 2895428424
310 2904540783
311 2912715401
312 2915770482
313 2918501728
314 2919473358
315 2922554874
316 2928143834
317 2935393041
318 2939747414
319 2939747415
320 2946045974
321 3003006335
322 3006491105
323 8003317149
324 8047711075
325 8055068258
326 8055173980

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22500

GMC_oxred_C_1st

GMC oxidoreductase, C-terminal

374

485

0.99

PF00890

FAD_binding_2

FAD binding domain

65

122

0.87

PF05199

GMC_oxred_C

GMC oxidoreductase

446

544

0.85

PF00732

GMC_oxred_N

GMC oxidoreductase

66

371

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cox-assembly1.cif.gz_A crystal structure of cholesterol oxidase complexed with a steroid substrate. implications for fad dependent alcohol oxidases 0.9842 40 535
1b8s-assembly1.cif.gz_A cholesterol oxidase from streptomyces glu361gln mutant 0.9818 45 535
3b6d-assembly1.cif.gz_A crystal structure of streptomyces cholesterol oxidase h447q/e361q mutant (1.2a) 0.9816 45 535
1cbo-assembly1.cif.gz_A cholesterol oxidase from streptomyces his447asn mutant 0.9814 45 535
1cc2-assembly1.cif.gz_A cholesterol oxidase from streptomyces his447gln mutant 0.9813 45 535
ID Description Score Start End Superfamily
af_P37127_327_452_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9907 47 77 3.50.50.60
af_M9NFH8_1768_1873_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9905 47 77 3.40.50.720
3coxA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9767 45 534 3.50.50.60
af_A0A1D6EP38_13_160_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9724 47 77 3.50.50.60
3coxA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9709 45 534 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A6B3HVI2-F1-model_v4 Cholesterol oxidase (EC 1.1.3.6) (EC 5.3.3.1) (Cholesterol isomerase) 0.995 82 535 GO:0016614
AF-A0A7Y6E578-F1-model_v4 Cholesterol oxidase (EC 1.1.3.6) (EC 5.3.3.1) (Cholesterol isomerase) 0.9946 131 535 GO:0016614
AF-Q27I64-F1-model_v4 Cholesterol oxidase (EC 1.1.3.6) (EC 5.3.3.1) (Cholesterol isomerase) 0.9942 258 511 GO:0016614
AF-A0A0B8NFD5-F1-model_v4 Cholesterol oxidase (EC 1.1.3.6) (EC 5.3.3.1) (Cholesterol isomerase) 0.9937 47 534 GO:0016614
AF-A0A0N0NG33-F1-model_v4 deleted 0.9934 229 535

Map