F247127

General Info

Members Datasets Scaffolds Average Seq Length
165 126 330 204

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0087950|Ga0501047_0087950_2111_2752
Length 213
Sequence MPDAMKLPGTQLEPGLVLFQGRLSRDEQRELWEMCRALAGGPAPMYTPTVRGGRKMSVGMLCLGRHWNALTYGYEDRRSDFDGLPVPPIPDRFASIARGAAADAGFAMSPDLCIMNFYTEAARMGVHQDKDERAETIARGVPIVSVSLGDAARFVIGGLTRREPTRPLVLRSGDVLVMGGPSRLRFHGVTRILPGTAPEGLGPGRFNLTFREW

Samples

Sample ID Description Type Environment
1 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
69 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
70 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
71 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
72 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
73 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
74 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
75 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
76 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
77 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
78 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
79 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
80 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
81 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
82 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
83 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
84 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
85 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
86 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
87 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
88 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
89 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
90 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
98 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
99 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
100 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
101 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
102 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
103 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
104 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
105 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
106 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
107 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
108 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
109 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
110 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
111 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
112 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
113 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
114 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
115 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
116 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
117 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
118 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
119 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
120 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
121 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
122 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
123 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
124 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
125 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
126 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.39
Metatranscriptomes 0.61
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.27
Nodule 0
Rhizoplane 3.64
Rhizosphere 89.09
Stem 0
Stem Tuber 0
Unclassified 23.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501047_0087950 3300049581 Bacteria 2984
2 Ga0065712_10089618 3300005290 Unclassified 2449
3 Ga0065712_10091702 3300005290 Bacteria 2361
4 Ga0065715_10111530 3300005293 Unclassified 2570
5 Ga0065715_10161896 3300005293 Bacteria 1621
6 Ga0070683_100040835 3300005329 Bacteria 4266
7 Ga0070670_100231879 3300005331 Bacteria 1607
8 Ga0070677_10398284 3300005333 Unclassified 725
9 Ga0068869_100044033 3300005334 Bacteria 3209
10 Ga0070669_100173742 3300005353 Bacteria 1681
11 Ga0070674_100433688 3300005356 Unclassified 1081
12 Ga0070673_100009145 3300005364 Bacteria 6637
13 Ga0070659_100071938 3300005366 Bacteria 2751
14 Ga0070713_100003844 3300005436 Bacteria 9947
15 Ga0070700_100028690 3300005441 Unclassified 3313
16 Ga0070699_100756208 3300005518 Unclassified 889
17 Ga0070672_100028436 3300005543 Bacteria 4183
18 Ga0070686_100032468 3300005544 Bacteria 3201
19 Ga0070686_100931566 3300005544 Bacteria 708
20 Ga0070693_100250812 3300005547 Bacteria 1173
21 Ga0070704_100698142 3300005549 Bacteria 900
22 Ga0070704_100732681 3300005549 Bacteria 879
23 Ga0068855_100220495 3300005563 Bacteria 2127
24 Ga0068854_100203543 3300005578 Bacteria 1557
25 Ga0070702_100036103 3300005615 Unclassified 2735
26 Ga0068852_100073870 3300005616 Bacteria 3001
27 Ga0068852_100107232 3300005616 Bacteria 2534
28 Ga0068859_100019019 3300005617 Bacteria 6898
29 Ga0068859_100950805 3300005617 Unclassified 942
30 Ga0068861_100066960 3300005719 Bacteria 2770
31 Ga0068860_100576952 3300005843 Bacteria 1129
32 Ga0068862_100830042 3300005844 Bacteria 904
33 Ga0070717_10194251 3300006028 Unclassified 1775
34 Ga0075368_10241108 3300006042 Unclassified 771
35 Ga0075364_10002453 3300006051 Bacteria 10390
36 Ga0075367_10048160 3300006178 Bacteria 2510
37 Ga0075366_10003545 3300006195 Bacteria 8250
38 Ga0075370_10043848 3300006353 Bacteria 2528
39 Ga0075428_100952250 3300006844 Unclassified 910
40 Ga0075431_100050956 3300006847 Bacteria 4269
41 Ga0075431_100354943 3300006847 Unclassified 1473
42 Ga0075431_100440942 3300006847 Bacteria 1299
43 Ga0075434_100089892 3300006871 Bacteria 3072
44 Ga0075434_100430154 3300006871 Bacteria 1341
45 Ga0097620_100019018 3300006931 Bacteria 6898
46 Ga0097620_100370346 3300006931 Bacteria 1528
47 Ga0097620_100950761 3300006931 Unclassified 942
48 Ga0114129_10000108 3300009147 Bacteria 81939
49 Ga0105243_10350647 3300009148 Bacteria 1355
50 Ga0105248_10157163 3300009177 Bacteria 2565
51 Ga0105239_10578099 3300010375 Bacteria 1280
52 Ga0157370_10199395 3300013104 Bacteria 1857
53 Ga0157380_10223936 3300014326 Bacteria 1685
54 Ga0206356_11428206 3300020070 Unclassified 1004
55 Ga0207688_10100930 3300025901 Unclassified 1666
56 Ga0207645_10038596 3300025907 Bacteria 3062
57 Ga0207650_10593002 3300025925 Unclassified 931
58 Ga0207659_10200329 3300025926 Bacteria 1594
59 Ga0207700_10208116 3300025928 Bacteria 1652
60 Ga0207690_10193425 3300025932 Unclassified 1540
61 Ga0207670_10049460 3300025936 Bacteria 2812
62 Ga0207669_10248514 3300025937 Unclassified 1323
63 Ga0207691_10164538 3300025940 Bacteria 1944
64 Ga0207689_10087814 3300025942 Unclassified 2554
65 Ga0207689_10320586 3300025942 Bacteria 1286
66 Ga0207679_10090817 3300025945 Bacteria 2362
67 Ga0207667_10065021 3300025949 Bacteria 3806
68 Ga0207640_11224204 3300025981 Unclassified 668
69 Ga0207658_10184280 3300025986 Bacteria 1730
70 Ga0207703_10117853 3300026035 Bacteria 2275
71 Ga0207708_10003944 3300026075 Bacteria 10921
72 Ga0207641_10139042 3300026088 Bacteria 2189
73 Ga0207648_10003721 3300026089 Bacteria 15963
74 Ga0207648_10326898 3300026089 Bacteria 1379
75 Ga0207676_10191663 3300026095 Bacteria 1799
76 Ga0207675_100621854 3300026118 Bacteria 1084
77 Ga0207683_10101640 3300026121 Bacteria 2567
78 Ga0207683_11009966 3300026121 Bacteria 772
79 Ga0207698_10083322 3300026142 Bacteria 2588
80 Ga0207698_10192431 3300026142 Unclassified 1819
81 Ga0268266_10772105 3300028379 Unclassified 928
82 Ga0268264_10810677 3300028381 Bacteria 936
83 Ga0307409_100210225 3300031995 Bacteria 1748
84 Ga0307416_101030556 3300032002 Unclassified 926
85 Ga0307415_100152326 3300032126 Bacteria 1781
86 Ga0307415_100342383 3300032126 Bacteria 1255
87 Ga0307415_101007068 3300032126 Bacteria 775
88 Ga0373960_0019115 3300035121 Bacteria 1796
89 Ga0373943_0480513 3300035170 Unclassified 724
90 Ga0373946_0236431 3300035171 Bacteria 887
91 Ga0373962_0182099 3300035242 Bacteria 703
92 Ga0373931_0343710 3300035691 Unclassified 932
93 Ga0373933_0002054 3300035724 Bacteria 11570
94 Ga0373947_0120112 3300035725 Unclassified 1668
95 Ga0373947_0287525 3300035725 Bacteria 1094
96 Ga0373937_0001203 3300036401 Bacteria 21757
97 Ga0373925_0032679 3300037068 Bacteria 3830
98 Ga0373925_0129821 3300037068 Unclassified 1964
99 Ga0395905_0705940 3300037471 Bacteria 911
100 Ga0451576_0723479 3300045051 Bacteria 1046
101 Ga0466967_0325445 3300045976 Bacteria 1483
102 Ga0495635_0208313 3300046663 Bacteria 1325
103 Ga0495602_0433952 3300048088 Unclassified 930
104 Ga0496104_0442898 3300048907 Bacteria 1211
105 Ga0496106_0042455 3300048909 Unclassified 3411
106 Ga0496109_0674644 3300048912 Unclassified 971
107 Ga0496112_0453470 3300048915 Bacteria 1220
108 Ga0496112_0619040 3300048915 Bacteria 1014
109 Ga0496113_0180152 3300048916 Bacteria 1675
110 Ga0501031_0111805 3300049568 Bacteria 1784
111 Ga0501036_0083670 3300049572 Bacteria 2698
112 Ga0501036_0170689 3300049572 Bacteria 1833
113 Ga0501038_0528926 3300049574 Bacteria 899
114 Ga0501040_0124106 3300049576 Bacteria 1813
115 Ga0501042_0078486 3300049578 Bacteria 2365
116 Ga0501042_0319265 3300049578 Bacteria 1122
117 Ga0501043_0575658 3300049579 Bacteria 834
118 Ga0501046_0134226 3300049580 Bacteria 1876
119 Ga0501067_0514290 3300049583 Bacteria 670
120 Ga0501069_0118656 3300049585 Bacteria 1510
121 Ga0501070_0821373 3300049586 Bacteria 729
122 Ga0501071_0041842 3300049587 Bacteria 3281
123 Ga0501072_0005347 3300049588 Bacteria 9774
124 Ga0501072_0024066 3300049588 Bacteria 4735
125 Ga0501072_0425217 3300049588 Unclassified 1053
126 Ga0501073_0329565 3300049589 Bacteria 1054
127 Ga0501074_0326614 3300049590 Bacteria 1089
128 Ga0501074_0380853 3300049590 Bacteria 1001
129 Ga0501075_0023429 3300049591 Bacteria 4521
130 Ga0501075_0130694 3300049591 Bacteria 1913
131 Ga0501075_0302807 3300049591 Bacteria 1218
132 Ga0501076_0024408 3300049592 Bacteria 4673
133 Ga0501077_0201632 3300049593 Bacteria 1264
134 Ga0501079_0102989 3300049741 Bacteria 2214
135 Ga0501080_0382472 3300049742 Bacteria 1268
136 Ga0501081_0019828 3300049743 Bacteria 4480
137 Ga0501081_0136159 3300049743 Bacteria 1758
138 Ga0501081_0311624 3300049743 Bacteria 1156
139 Ga0501045_0058331 3300049824 Bacteria 2826
140 Ga0501045_0754684 3300049824 Unclassified 717
141 nmdc:mga03683_15965_c1 3300050489 Bacteria 2812
142 nmdc:mga00v17_43807_c1 3300050491 Bacteria 2697
143 nmdc:mga00v17_5944_c1 3300050491 Bacteria 6454
144 nmdc:mga0k408_11466_c1 3300050493 Bacteria 4828
145 nmdc:mga0k408_2528_c1 3300050493 Bacteria 9725
146 nmdc:mga06z11_20860_c1 3300050494 Bacteria 3035
147 nmdc:mga05p37_2012_c1 3300050507 Bacteria 23716
148 nmdc:mga05p37_641476_c1 3300050507 Unclassified 1191
149 nmdc:mga06r32_15843_c1 3300050510 Bacteria 6856
150 nmdc:mga06r32_399861_c1 3300050510 Unclassified 1356
151 nmdc:mga06r32_421730_c1 3300050510 Bacteria 1315
152 nmdc:mga06r32_596264_c1 3300050510 Unclassified 1076
153 nmdc:mga0rr50_27862_c1 3300050513 Bacteria 3963
154 nmdc:mga08x19_247590_c1 3300050514 Unclassified 1230
155 nmdc:mga0a205_205425_c1 3300050515 Bacteria 1331
156 nmdc:mga0a205_82172_c1 3300050515 Bacteria 3112
157 Ga0495601_0141132 3300053077 Bacteria 1571
158 Ga0495595_0065198 3300053084 Bacteria 1713
159 Ga0495619_0051296 3300053085 Bacteria 2726
160 Ga0500628_039952 3300053129 Unclassified 1066
161 Ga0501084_0685374 3300054114 Unclassified 864
162 Ga0501082_0069758 3300060353 Bacteria 3027
163 Ga0501082_0089992 3300060353 Bacteria 2650
164 Ga0501082_0104083 3300060353 Unclassified 2456
165 Ga0530510_0306279 3300061734 Bacteria 1189
166 Ga0501047_0087950
167 Ga0065712_10089618
168 Ga0065712_10091702
169 Ga0065715_10111530
170 Ga0065715_10161896
171 Ga0070683_100040835
172 Ga0070670_100231879
173 Ga0070677_10398284
174 Ga0068869_100044033
175 Ga0070669_100173742
176 Ga0070674_100433688
177 Ga0070673_100009145
178 Ga0070659_100071938
179 Ga0070713_100003844
180 Ga0070700_100028690
181 Ga0070699_100756208
182 Ga0070672_100028436
183 Ga0070686_100032468
184 Ga0070686_100931566
185 Ga0070693_100250812
186 Ga0070704_100698142
187 Ga0070704_100732681
188 Ga0068855_100220495
189 Ga0068854_100203543
190 Ga0070702_100036103
191 Ga0068852_100073870
192 Ga0068852_100107232
193 Ga0068859_100019019
194 Ga0068859_100950805
195 Ga0068861_100066960
196 Ga0068860_100576952
197 Ga0068862_100830042
198 Ga0070717_10194251
199 Ga0075368_10241108
200 Ga0075364_10002453
201 Ga0075367_10048160
202 Ga0075366_10003545
203 Ga0075370_10043848
204 Ga0075428_100952250
205 Ga0075431_100050956
206 Ga0075431_100354943
207 Ga0075431_100440942
208 Ga0075434_100089892
209 Ga0075434_100430154
210 Ga0097620_100019018
211 Ga0097620_100370346
212 Ga0097620_100950761
213 Ga0114129_10000108
214 Ga0105243_10350647
215 Ga0105248_10157163
216 Ga0105239_10578099
217 Ga0157370_10199395
218 Ga0157380_10223936
219 Ga0206356_11428206
220 Ga0207688_10100930
221 Ga0207645_10038596
222 Ga0207650_10593002
223 Ga0207659_10200329
224 Ga0207700_10208116
225 Ga0207690_10193425
226 Ga0207670_10049460
227 Ga0207669_10248514
228 Ga0207691_10164538
229 Ga0207689_10087814
230 Ga0207689_10320586
231 Ga0207679_10090817
232 Ga0207667_10065021
233 Ga0207640_11224204
234 Ga0207658_10184280
235 Ga0207703_10117853
236 Ga0207708_10003944
237 Ga0207641_10139042
238 Ga0207648_10003721
239 Ga0207648_10326898
240 Ga0207676_10191663
241 Ga0207675_100621854
242 Ga0207683_10101640
243 Ga0207683_11009966
244 Ga0207698_10083322
245 Ga0207698_10192431
246 Ga0268266_10772105
247 Ga0268264_10810677
248 Ga0307409_100210225
249 Ga0307416_101030556
250 Ga0307415_100152326
251 Ga0307415_100342383
252 Ga0307415_101007068
253 Ga0373960_0019115
254 Ga0373943_0480513
255 Ga0373946_0236431
256 Ga0373962_0182099
257 Ga0373931_0343710
258 Ga0373933_0002054
259 Ga0373947_0120112
260 Ga0373947_0287525
261 Ga0373937_0001203
262 Ga0373925_0032679
263 Ga0373925_0129821
264 Ga0395905_0705940
265 Ga0451576_0723479
266 Ga0466967_0325445
267 Ga0495635_0208313
268 Ga0495602_0433952
269 Ga0496104_0442898
270 Ga0496106_0042455
271 Ga0496109_0674644
272 Ga0496112_0453470
273 Ga0496112_0619040
274 Ga0496113_0180152
275 Ga0501031_0111805
276 Ga0501036_0083670
277 Ga0501036_0170689
278 Ga0501038_0528926
279 Ga0501040_0124106
280 Ga0501042_0078486
281 Ga0501042_0319265
282 Ga0501043_0575658
283 Ga0501046_0134226
284 Ga0501067_0514290
285 Ga0501069_0118656
286 Ga0501070_0821373
287 Ga0501071_0041842
288 Ga0501072_0005347
289 Ga0501072_0024066
290 Ga0501072_0425217
291 Ga0501073_0329565
292 Ga0501074_0326614
293 Ga0501074_0380853
294 Ga0501075_0023429
295 Ga0501075_0130694
296 Ga0501075_0302807
297 Ga0501076_0024408
298 Ga0501077_0201632
299 Ga0501079_0102989
300 Ga0501080_0382472
301 Ga0501081_0019828
302 Ga0501081_0136159
303 Ga0501081_0311624
304 Ga0501045_0058331
305 Ga0501045_0754684
306 nmdc:mga03683_15965_c1
307 nmdc:mga00v17_43807_c1
308 nmdc:mga00v17_5944_c1
309 nmdc:mga0k408_11466_c1
310 nmdc:mga0k408_2528_c1
311 nmdc:mga06z11_20860_c1
312 nmdc:mga05p37_2012_c1
313 nmdc:mga05p37_641476_c1
314 nmdc:mga06r32_15843_c1
315 nmdc:mga06r32_399861_c1
316 nmdc:mga06r32_421730_c1
317 nmdc:mga06r32_596264_c1
318 nmdc:mga0rr50_27862_c1
319 nmdc:mga08x19_247590_c1
320 nmdc:mga0a205_205425_c1
321 nmdc:mga0a205_82172_c1
322 Ga0495601_0141132
323 Ga0495595_0065198
324 Ga0495619_0051296
325 Ga0500628_039952
326 Ga0501084_0685374
327 Ga0501082_0069758
328 Ga0501082_0089992
329 Ga0501082_0104083
330 Ga0530510_0306279

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13532

2OG-FeII_Oxy_2

2OG-Fe(II) oxygenase superfamily

15

211

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xoi-assembly1.cif.gz_A the structure of osalkbh1 0.9236 1 204
5xoi-assembly1.cif.gz_A the structure of osalkbh1 0.9193 1 204
3khc-assembly1.cif.gz_B crystal structure of escherichia coli alkb in complex with ssdna containing a 1-methylguanine lesion 0.9149 1 204
4nii-assembly1.cif.gz_A crystal structure of alkb d135i mutant protein with cofactors bound to dsdna containing m6a/a 0.913 3 204
3bkz-assembly1.cif.gz_A x-ray structure of e coli alkb crosslinked to dsdna in the active site 0.9129 6 204
ID Description Score Start End Superfamily
af_C6TKW1_99_311_2.60.120.590 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.9178 1 204 2.60.120.590
af_Q10BI5_146_293_2.60.120.590 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.9161 1 119 2.60.120.590
af_C6TKW1_99_311_2.60.120.590 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.9135 1 204 2.60.120.590
4niiA00 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.913 3 204 2.60.120.590
4niiA00 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.8869 3 204 2.60.120.590
ID Description Score Start End GO Terms
AF-A0A2V8DVL2-F1-model_v4 Alpha-ketoglutarate-dependent dioxygenase AlkB 0.9772 1 203 GO:0005737
GO:0006281
GO:0008198
GO:0035513
GO:0035515
GO:0035516
AF-A0A1Q7AGG2-F1-model_v4 Alpha-ketoglutarate-dependent dioxygenase AlkB-like domain-containing protein 0.9769 1 182 GO:0005737
GO:0006281
GO:0008198
GO:0035513
GO:0035515
GO:0035516
AF-E3T6V8-F1-model_v4 Fe2OG dioxygenase domain-containing protein 0.9753 1 204 GO:0005737
GO:0006281
GO:0008198
GO:0035513
GO:0035515
GO:0035516
AF-A0A2D6R080-F1-model_v4 Fe2OG dioxygenase domain-containing protein 0.9748 1 203 GO:0005737
GO:0006281
GO:0008198
GO:0035513
GO:0035515
GO:0035516
AF-E3T6V8-F1-model_v4 Fe2OG dioxygenase domain-containing protein 0.9706 1 204 GO:0005737
GO:0006281
GO:0008198
GO:0035513
GO:0035515
GO:0035516

Map