F247037

General Info

Members Datasets Scaffolds Average Seq Length
165 122 328 172

Family's Representative Sequence

Representative Sequence 3300048923|Ga0496120_0001548|Ga0496120_0001548_19463_19975
Length 155
Sequence LFWFGIHALIAFATTVGLGMAGFRVNFTPSEPLGLWRIVELDGKLRIGDLIFICPPPTDSMLEARDRGYLRRGLCAGGFAPLIKTVAAVSGQTVKVSEEVFIDGRAMKPYEGGVVPLCAIYLHSAFSSSFDSRYFGPLAVKGVLGYAHEVWTYAP

Samples

Sample ID Description Type Environment
1 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
6 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
9 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
10 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
11 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
12 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
13 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
14 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
15 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
16 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
17 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
18 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
19 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
20 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
21 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
22 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
23 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
24 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
25 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
27 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
28 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
29 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
30 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
31 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
32 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
33 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
34 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
35 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
36 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
37 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
38 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
39 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
40 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
41 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
42 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
43 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
44 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
45 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
46 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
47 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
48 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
49 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
50 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
51 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
52 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
53 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
54 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
55 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
56 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
57 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
58 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
59 2516143018 Ensifer sp. BR816 Isolate Nodule
60 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
61 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
62 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
63 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
64 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
65 2643221558 Rhizobium sp. Root149 Isolate Unclassified
66 2643221607 Rhizobium sp. Root73 Isolate Unclassified
67 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
68 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
69 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
70 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
71 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
72 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
73 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
74 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
75 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
76 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
77 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
78 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
79 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
80 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
81 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
82 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
83 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
84 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
85 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
86 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
87 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
88 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
89 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
90 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
91 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
92 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
93 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
94 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
95 2904699407
96 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
97 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
98 2922368715
99 2922425934
100 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
101 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
102 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
103 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
104 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
105 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
106 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
107 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
108 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
109 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
110 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
111 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
112 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
113 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
114 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
115 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
116 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
117 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
118 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
119 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
120 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
121 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
122 8054558443 Rhizobium alarense TRM95111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 56.17
Metatranscriptomes 0
Isolates 43.83

Biome Distribution

Category Percentage (%)
Aerial Root 0.61
Bulb 0
Endosphere 15.76
Nodule 27.88
Rhizoplane 3.64
Rhizosphere 15.76
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496120_0001548 3300048923 Bacteria 26898
2 JGI25162J39368_1002293 3300002737 Bacteria 7688
3 JGI25165J46597_1000490 3300003214 Bacteria 38158
4 JGI25153J46596_10004490 3300003215 Bacteria 7516
5 Ga0055539_1017428 3300003752 Bacteria 868
6 Ga0055540_1006168 3300003792 Bacteria 4822
7 Ga0055531_10005332 3300003794 Bacteria 7545
8 Ga0055531_10011529 3300003794 Bacteria 4249
9 Ga0055531_10011823 3300003794 Bacteria 4166
10 Ga0070665_100675597 3300005548 Bacteria 1046
11 Ga0099826_10000032 3300006948 Bacteria 122288
12 Ga0105237_10000384 3300009545 Bacteria 62866
13 Ga0105239_10000065 3300010375 Bacteria 151224
14 Ga0105239_10000394 3300010375 Bacteria 64001
15 Ga0157373_10061741 3300013100 Bacteria 2654
16 Ga0157370_10000054 3300013104 Bacteria 118718
17 Ga0157370_10615567 3300013104 Bacteria 994
18 Ga0157369_10624995 3300013105 Bacteria 1111
19 Ga0182008_10171549 3300014497 Bacteria 1095
20 Ga0182007_10018607 3300015262 Bacteria 2513
21 Ga0209672_107666 3300025228 Bacteria 1645
22 Ga0209437_100326 3300025233 Bacteria 60536
23 Ga0209677_100871 3300025253 Bacteria 14852
24 Ga0209233_1000384 3300025261 Bacteria 38210
25 Ga0209233_1000528 3300025261 Bacteria 21882
26 Ga0209758_1000168 3300025297 Bacteria 150965
27 Ga0209051_1003029 3300025303 Bacteria 11374
28 Ga0209257_1000319 3300025304 Bacteria 100552
29 Ga0209257_1000741 3300025304 Bacteria 49326
30 Ga0209371_1034186 3300027312 Bacteria 1079
31 Ga0268266_10241689 3300028379 Bacteria 1667
32 Ga0307515_10196254 3300028794 Bacteria 1910
33 Ga0268256_1033028 3300030500 Bacteria 1226
34 Ga0307405_10001082 3300031731 Bacteria 11104
35 Ga0395905_0323164 3300037471 Bacteria 1433
36 Ga0439465_0053026 3300041413 Bacteria 1332
37 Ga0451837_0673439 3300041494 Bacteria 1242
38 Ga0451849_0637580 3300041505 Bacteria 5444
39 Ga0451849_1043124 3300041505 Bacteria 1316
40 Ga0495607_0010722 3300046501 Bacteria 6140
41 Ga0495607_0026902 3300046501 Bacteria 3565
42 Ga0495648_0167355 3300046524 Plasmid 1130
43 Ga0495622_0064697 3300046557 Bacteria 1691
44 Ga0495687_004727 3300047443 Bacteria 9024
45 Ga0496106_0001348 3300048909 Bacteria 18406
46 Ga0496112_0818909 3300048915 Bacteria 855
47 Ga0496113_0002058 3300048916 Bacteria 11558
48 Ga0496116_0001726 3300048919 Bacteria 23861
49 Ga0496116_0010879 3300048919 Bacteria 7586
50 Ga0496117_0002417 3300048920 Bacteria 23697
51 Ga0496117_0045489 3300048920 Bacteria 3169
52 Ga0496118_0015254 3300048921 Bacteria 7127
53 Ga0496118_0025913 3300048921 Bacteria 5013
54 Ga0496118_0062289 3300048921 Bacteria 2755
55 Ga0496119_0000504 3300048922 Bacteria 53242
56 Ga0496119_0000615 3300048922 Bacteria 48067
57 Ga0496119_0005797 3300048922 Bacteria 11686
58 Ga0496119_0020940 3300048922 Bacteria 4743
59 Ga0496120_0000974 3300048923 Bacteria 39045
60 Ga0496120_0005238 3300048923 Bacteria 10421
61 Ga0496121_0123250 3300048924 Bacteria 1953
62 Ga0496122_0000426 3300048925 Bacteria 89190
63 Ga0496122_0000551 3300048925 Bacteria 77456
64 Ga0496122_0000605 3300048925 Bacteria 73607
65 Ga0496122_0000689 3300048925 Bacteria 67297
66 Ga0496122_0010727 3300048925 Bacteria 9398
67 Ga0496123_0000046 3300048926 Bacteria 244844
68 Ga0496123_0000380 3300048926 Bacteria 83326
69 Ga0496123_0000491 3300048926 Bacteria 68777
70 Ga0496123_0002000 3300048926 Bacteria 26337
71 Ga0496123_0002390 3300048926 Bacteria 23485
72 Ga0496124_0000227 3300048927 Bacteria 110314
73 Ga0496124_0192419 3300048927 Bacteria 1559
74 Ga0496124_0203272 3300048927 Bacteria 1504
75 Ga0496125_0000182 3300048928 Bacteria 137747
76 Ga0496125_0000411 3300048928 Bacteria 80323
77 Ga0496125_0024316 3300048928 Bacteria 5573
78 Ga0496125_0066192 3300048928 Bacteria 2857
79 Ga0496126_0000471 3300048929 Bacteria 80080
80 Ga0496126_0000485 3300048929 Bacteria 78597
81 Ga0496126_0009871 3300048929 Bacteria 10099
82 Ga0500618_000118 3300053125 Bacteria 64472
83 Ga0500618_000641 3300053125 Bacteria 20905
84 Ga0500618_001229 3300053125 Bacteria 12003
85 Ga0500573_0003638 3300053140 Bacteria 8000
86 Ga0500604_0048762 3300053151 Bacteria 1301
87 Ga0500636_0000117 3300053177 Bacteria 41476
88 Ga0500636_0032433 3300053177 Bacteria 3091
89 Ga0500636_0040130 3300053177 Bacteria 2768
90 Ga0500636_0099499 3300053177 Bacteria 1655
91 2509112617 2508501122 Bacteria 6292184
92 2513599326 2513237088 Bacteria 6927906
93 2513913758 2513237144 Bacteria 7530820
94 2513998863 2513237159 Bacteria 6810126
95 2514000697 2513237159 Bacteria 6810126
96 2515108455 2515075009 Bacteria 7288508
97 2516210509 2516143018 Bacteria 6951533
98 2524541757 2524023228 Bacteria 10118060
99 2585169362 2582581283 Bacteria 6030556
100 2585327110 2582581315 Bacteria 7318924
101 2585555100 2585427530 Bacteria 7383882
102 2599335998 2599185156 Bacteria 5403036
103 2599336040 2599185156 Bacteria 5403036
104 2643815090 2643221558 Bacteria 5460675
105 2644049058 2643221607 Bacteria 6314006
106 2644481808 2643221686 Bacteria 6310811
107 2644497856 2643221689 Bacteria 6042950
108 2671116925 2667528174 Bacteria 6435400
109 2776268130 2775506902 Bacteria 6208009
110 2776283301 2775506904 Bacteria 5954060
111 2776911632 2775507049 Bacteria 6284736
112 2792642594 2791355094 Bacteria 7011481
113 2819642749 2818991453 Bacteria 7181617
114 2821129790 2821123053 Bacteria 7836056
115 2839998522 2839993093 Bacteria 5512535
116 2841856740 2841851746 Bacteria 7532261
117 2842488582 2842482326 Bacteria 7212537
118 2842524084 2842521101 Bacteria 6569494
119 2842526635 2842521101 Bacteria 6569494
120 2856342693 2856342000 Bacteria 7176905
121 2856371674 2856364286 Bacteria 6939991
122 2857357445 2857349434 Bacteria 7926032
123 2869259973 2869256925 Bacteria 6981691
124 2869289404 2869285874 Bacteria 6901219
125 2871431471 2871429161 Bacteria 6547891
126 2874154608 2874146452 Bacteria 7533118
127 2874161993 2874155637 Bacteria 6724144
128 2876420177 2876413966 Bacteria 6831344
129 2878748076 2878745973 Bacteria 6867388
130 2896390316 2896384573 Bacteria 7700774
131 2899804939 2899803654 Bacteria 5577784
132 2899849132 2899845264 Bacteria 5672268
133 2903493480 2903492973 Bacteria 13473544
134 2903777331 2903768456 Bacteria 9749579
135 2904699572
136 2906311693 2906308376 Bacteria 6841989
137 2906323432 2906321335 Bacteria 6579571
138 2922378958
139 2922434692
140 2933599301 2933594066 Bacteria 5594265
141 2935899334 2935894831 Bacteria 6620579
142 2937818487 2937813078 Bacteria 7783518
143 2958048415 2958041894 Bacteria 13082850
144 2958068876 2958064165 Bacteria 7158582
145 2958077410 2958071322 Bacteria 6815895
146 2958133778 2958130278 Bacteria 6897202
147 2958183424 2958179912 Bacteria 6874908
148 2961081389 2961077736 Bacteria 7079850
149 2977850762 2977843712 Bacteria 6753583
150 2978974954 2978969890 Bacteria 5400756
151 2984589042 2984587000 Bacteria 5263363
152 2987644834 2987636660 Bacteria 8088555
153 2989781247 2989776772 Bacteria 4843317
154 3004211018 3004203850 Bacteria 7307914
155 3005420663 3005416602 Bacteria 7064308
156 8004391282 8004387939 Bacteria 7049250
157 8004716652 8004714634 Bacteria 6776161
158 8005320031 8005314921 Bacteria 7072929
159 8006983979 8006973647 Bacteria 10679141
160 8006984191 8006973647 Bacteria 10679141
161 8018130537 8018127388 Bacteria 7351159
162 8018134390 8018127388 Bacteria 7351159
163 8019648127 8019638758 Bacteria 9062356
164 8054560495 8054558443 Bacteria 5204801
165 Ga0496120_0001548
166 JGI25162J39368_1002293
167 JGI25165J46597_1000490
168 JGI25153J46596_10004490
169 Ga0055539_1017428
170 Ga0055540_1006168
171 Ga0055531_10005332
172 Ga0055531_10011529
173 Ga0055531_10011823
174 Ga0070665_100675597
175 Ga0099826_10000032
176 Ga0105237_10000384
177 Ga0105239_10000065
178 Ga0105239_10000394
179 Ga0157373_10061741
180 Ga0157370_10000054
181 Ga0157370_10615567
182 Ga0157369_10624995
183 Ga0182008_10171549
184 Ga0182007_10018607
185 Ga0209672_107666
186 Ga0209437_100326
187 Ga0209677_100871
188 Ga0209233_1000384
189 Ga0209233_1000528
190 Ga0209758_1000168
191 Ga0209051_1003029
192 Ga0209257_1000319
193 Ga0209257_1000741
194 Ga0209371_1034186
195 Ga0268266_10241689
196 Ga0307515_10196254
197 Ga0268256_1033028
198 Ga0307405_10001082
199 Ga0395905_0323164
200 Ga0439465_0053026
201 Ga0451837_0673439
202 Ga0451849_0637580
203 Ga0451849_1043124
204 Ga0495607_0010722
205 Ga0495607_0026902
206 Ga0495648_0167355
207 Ga0495622_0064697
208 Ga0495687_004727
209 Ga0496106_0001348
210 Ga0496112_0818909
211 Ga0496113_0002058
212 Ga0496116_0001726
213 Ga0496116_0010879
214 Ga0496117_0002417
215 Ga0496117_0045489
216 Ga0496118_0015254
217 Ga0496118_0025913
218 Ga0496118_0062289
219 Ga0496119_0000504
220 Ga0496119_0000615
221 Ga0496119_0005797
222 Ga0496119_0020940
223 Ga0496120_0000974
224 Ga0496120_0005238
225 Ga0496121_0123250
226 Ga0496122_0000426
227 Ga0496122_0000551
228 Ga0496122_0000605
229 Ga0496122_0000689
230 Ga0496122_0010727
231 Ga0496123_0000046
232 Ga0496123_0000380
233 Ga0496123_0000491
234 Ga0496123_0002000
235 Ga0496123_0002390
236 Ga0496124_0000227
237 Ga0496124_0192419
238 Ga0496124_0203272
239 Ga0496125_0000182
240 Ga0496125_0000411
241 Ga0496125_0024316
242 Ga0496125_0066192
243 Ga0496126_0000471
244 Ga0496126_0000485
245 Ga0496126_0009871
246 Ga0500618_000118
247 Ga0500618_000641
248 Ga0500618_001229
249 Ga0500573_0003638
250 Ga0500604_0048762
251 Ga0500636_0000117
252 Ga0500636_0032433
253 Ga0500636_0040130
254 Ga0500636_0099499
255 2509112617
256 2513599326
257 2513913758
258 2513998863
259 2514000697
260 2515108455
261 2516210509
262 2524541757
263 2585169362
264 2585327110
265 2585555100
266 2599335998
267 2599336040
268 2643815090
269 2644049058
270 2644481808
271 2644497856
272 2671116925
273 2776268130
274 2776283301
275 2776911632
276 2792642594
277 2819642749
278 2821129790
279 2839998522
280 2841856740
281 2842488582
282 2842524084
283 2842526635
284 2856342693
285 2856371674
286 2857357445
287 2869259973
288 2869289404
289 2871431471
290 2874154608
291 2874161993
292 2876420177
293 2878748076
294 2896390316
295 2899804939
296 2899849132
297 2903493480
298 2903777331
299 2904699572
300 2906311693
301 2906323432
302 2922378958
303 2922434692
304 2933599301
305 2935899334
306 2937818487
307 2958048415
308 2958068876
309 2958077410
310 2958133778
311 2958183424
312 2961081389
313 2977850762
314 2978974954
315 2984589042
316 2987644834
317 2989781247
318 3004211018
319 3005420663
320 8004391282
321 8004716652
322 8005320031
323 8006983979
324 8006984191
325 8018130537
326 8018134390
327 8019648127
328 8054560495

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10502

Peptidase_S26

Signal peptidase, peptidase S26

1

113

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4k8w-assembly1.cif.gz_A-2 an arm-swapped dimer of the s. pyogenes pilin specific assembly factor sipa 0.7073 45 172
4n31-assembly1.cif.gz_A structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation 0.6517 28 172
4n31-assembly1.cif.gz_B structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation 0.6465 28 176
4k8w-assembly1.cif.gz_A-2 an arm-swapped dimer of the s. pyogenes pilin specific assembly factor sipa 0.6458 45 172
4n31-assembly1.cif.gz_B structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation 0.6265 28 176
ID Description Score Start End Superfamily
af_Q54RP1_162_281_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.7345 29 175 2.10.109.10
4k8wA00 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.7073 45 172 2.10.109.10
af_O04348_174_312_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.6824 29 167 2.10.109.10
af_Q54RP1_162_281_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.6618 29 175 2.10.109.10
af_O04348_174_312_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.6607 29 167 2.10.109.10
ID Description Score Start End GO Terms
AF-P15595-F1-model_v4 Conjugal transfer protein TraF 0.9823 1 176 GO:0004252
GO:0006465
GO:0042597
AF-A0A528JI88-F1-model_v4 Conjugative transfer signal peptidase TraF 0.9819 38 176 GO:0004252
GO:0006465
GO:0042597
AF-A0A2L1CLM9-F1-model_v4 deleted 0.981 9 176
AF-A0A7Y2R7P3-F1-model_v4 Conjugative transfer signal peptidase TraF 0.9797 1 176 GO:0004252
GO:0006465
GO:0016020
GO:0042597
AF-A0A3S3WDR2-F1-model_v4 deleted 0.9796 4 176

Map