F247018

General Info

Members Datasets Scaffolds Average Seq Length
165 111 330 603

Family's Representative Sequence

Representative Sequence 3300048915|Ga0496112_0107335|Ga0496112_0107335_399_2666
Length 687
Sequence MRFVSNSFVSLAATVLCILPAPAVPQTKLHQSRQVNSVAVREWEKRVMSKDAKIRAAAEAALVQDPVRSLPLLRRFLNRPNEDLHEATFEIIRRIGPPAIPLLVELLQKQPVSFRRFAADAMIDLAPQTESIQPALRRALRDEDAMVAGDAARALGALHKRANPSVGALLKTLSHEDPYVRIYAAEALASIGPPAGATKEHSAHDPTLRNEAEWALNRIAGVESRESDVSKPATPIASQTTVVQTGNPPVDWDTRTGRNIVWSVELGNQTFGRPVVAGNVVYVGTDNARAMNPAYTEESGVLLAFRATDGEFLWQDVAPRVERGLREFLLPSTTSAPYIEGNRLYYVTAECQLRCLDTQGFRDGENNGPYREELFQDNAAADIIWELDMCGRLGVFPHEATNSEVLPLGDLLLVSTSNGQNEGHTLVPSPRAPSLIAVDKRSGEVVWRAIGAGANVLHGQWSSPVAANVNGRTQVLFGGGDGWLRAYDAASGHEVWRFDGNPKDAPWLPRAGVLSRSFIVASPVFADGRVFIAMGQSPGHGNGPSFIHAINPNGQGDVTKSRLLWTSRDVGRVVGTPIVKDGLLYVGDVGGTIYCLDAATGALVWKHETNXXXXGSLLLAGDRLYVGNEEGLMTVLRAGRRKELLAEIEMDAPLYSPPALVGDALFLATANRLYLIAAKPQSSSVQR

Samples

Sample ID Description Type Environment
1 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
72 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
74 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
75 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
76 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
77 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
78 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
79 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
80 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
81 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
82 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
83 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
84 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
85 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
86 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
87 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
88 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
94 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
95 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
96 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
97 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
98 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
99 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
100 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
101 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
102 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
103 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
104 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
105 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
106 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
107 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
108 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
109 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
110 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
111 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.82
Nodule 0
Rhizoplane 3.64
Rhizosphere 94.55
Stem 0
Stem Tuber 0
Unclassified 11.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496112_0107335 3300048915 Bacteria 2762
2 JGI24751J29686_10000111 3300002459 Bacteria 42772
3 Ga0065712_10003021 3300005290 Bacteria 7551
4 Ga0065712_10007876 3300005290 Bacteria 3689
5 Ga0065712_10068702 3300005290 Bacteria 9325
6 Ga0065712_10069197 3300005290 Bacteria 7759
7 Ga0065715_10090238 3300005293 Bacteria 7375
8 Ga0065715_10099519 3300005293 Unclassified 3383
9 Ga0070683_100011903 3300005329 Bacteria 7543
10 Ga0070690_100015857 3300005330 Bacteria 4501
11 Ga0070670_100000216 3300005331 Bacteria 53372
12 Ga0070670_100020552 3300005331 Bacteria 5677
13 Ga0070666_10024840 3300005335 Plasmid 3906
14 Ga0070675_100000029 3300005354 Bacteria 102686
15 Ga0070675_100034542 3300005354 Bacteria 4104
16 Ga0070671_100076923 3300005355 Unclassified 2788
17 Ga0070674_100001874 3300005356 Bacteria 11413
18 Ga0070673_100019970 3300005364 Bacteria 4823
19 Ga0070667_100040164 3300005367 Bacteria 3923
20 Ga0070703_10002447 3300005406 Bacteria 5349
21 Ga0070705_100004886 3300005440 Bacteria 6528
22 Ga0070705_100011654 3300005440 Bacteria 4444
23 Ga0070700_100000056 3300005441 Bacteria 83455
24 Ga0070700_100035814 3300005441 Bacteria 3006
25 Ga0070699_100001524 3300005518 Bacteria 21181
26 Ga0070684_100001241 3300005535 Bacteria 18301
27 Ga0070686_100002047 3300005544 Bacteria 11161
28 Ga0070686_100002219 3300005544 Bacteria 10728
29 Ga0070686_100040435 3300005544 Bacteria 2909
30 Ga0070664_100008634 3300005564 Bacteria 8246
31 Ga0070664_100016331 3300005564 Bacteria 6086
32 Ga0068857_100014852 3300005577 Bacteria 6791
33 Ga0070702_100006219 3300005615 Bacteria 5635
34 Ga0068859_100047352 3300005617 Bacteria 4320
35 Ga0068864_100006963 3300005618 Bacteria 9273
36 Ga0068861_100009769 3300005719 Bacteria 6635
37 Ga0068861_100018298 3300005719 Bacteria 4990
38 Ga0068863_100055720 3300005841 Plasmid 3743
39 Ga0068858_100014323 3300005842 Bacteria 7478
40 Ga0068860_100053709 3300005843 Bacteria 3830
41 Ga0081455_10037098 3300005937 Bacteria 4332
42 Ga0075365_10015609 3300006038 Bacteria 4598
43 Ga0075428_100000014 3300006844 Bacteria 166411
44 Ga0075428_100008217 3300006844 Bacteria 11575
45 Ga0075428_100009380 3300006844 Bacteria 10856
46 Ga0075428_100042470 3300006844 Unclassified 4999
47 Ga0075428_100048496 3300006844 Bacteria 4661
48 Ga0075430_100018036 3300006846 Bacteria 6007
49 Ga0075431_100100955 3300006847 Bacteria 2977
50 Ga0075434_100047380 3300006871 Bacteria 4266
51 Ga0075429_100013783 3300006880 Bacteria 7010
52 Ga0075429_100023763 3300006880 Bacteria 5319
53 Ga0097620_100029070 3300006931 Bacteria 5546
54 Ga0097620_100037966 3300006931 Bacteria 4833
55 Ga0097620_100047350 3300006931 Bacteria 4320
56 Ga0075435_100006683 3300007076 Bacteria 8178
57 Ga0075435_100047461 3300007076 Bacteria 3449
58 Ga0111539_10000391 3300009094 Bacteria 54306
59 Ga0111539_10016714 3300009094 Bacteria 9092
60 Ga0111539_10023223 3300009094 Bacteria 7618
61 Ga0111539_10028211 3300009094 Bacteria 6850
62 Ga0105247_10005370 3300009101 Bacteria 8075
63 Ga0114129_10001461 3300009147 Bacteria 31932
64 Ga0114129_10114441 3300009147 Bacteria 3719
65 Ga0105242_10000012 3300009176 Bacteria 136893
66 Ga0105248_10010232 3300009177 Bacteria 10326
67 Ga0105248_10033210 3300009177 Bacteria 5764
68 Ga0105248_10109890 3300009177 Bacteria 3108
69 Ga0105237_10000199 3300009545 Bacteria 85277
70 Ga0157375_10000021 3300013308 Bacteria 249616
71 Ga0163163_10000250 3300014325 Bacteria 54990
72 Ga0163163_10051509 3300014325 Unclassified 4060
73 Ga0157380_10035690 3300014326 Unclassified 3841
74 Ga0207697_10000638 3300025315 Bacteria 19975
75 Ga0207653_10000997 3300025885 Bacteria 9341
76 Ga0207645_10004910 3300025907 Bacteria 9806
77 Ga0207643_10017654 3300025908 Bacteria 3903
78 Ga0207671_10001695 3300025914 Bacteria 24956
79 Ga0207662_10001717 3300025918 Bacteria 10727
80 Ga0207681_10027790 3300025923 Bacteria 3661
81 Ga0207650_10000269 3300025925 Bacteria 54998
82 Ga0207650_10025545 3300025925 Unclassified 4208
83 Ga0207659_10000073 3300025926 Bacteria 64021
84 Ga0207659_10013247 3300025926 Bacteria 5274
85 Ga0207659_10079224 3300025926 Unclassified 2423
86 Ga0207700_10018061 3300025928 Bacteria 4728
87 Ga0207709_10000029 3300025935 Bacteria 333327
88 Ga0207669_10002070 3300025937 Bacteria 8495
89 Ga0207691_10018168 3300025940 Bacteria 6662
90 Ga0207711_10002981 3300025941 Bacteria 14789
91 Ga0207711_10011272 3300025941 Bacteria 7429
92 Ga0207711_10016477 3300025941 Bacteria 6140
93 Ga0207711_10029487 3300025941 Unclassified 4629
94 Ga0207689_10003739 3300025942 Bacteria 13870
95 Ga0207661_10037798 3300025944 Unclassified 3778
96 Ga0207651_10058299 3300025960 Unclassified 2668
97 Ga0207677_10043360 3300026023 Bacteria 2990
98 Ga0207708_10000042 3300026075 Bacteria 123302
99 Ga0207641_10013178 3300026088 Bacteria 6778
100 Ga0207676_10069992 3300026095 Bacteria 2812
101 Ga0207674_10022360 3300026116 Bacteria 6790
102 Ga0207675_100007496 3300026118 Bacteria 10306
103 Ga0207675_100014724 3300026118 Bacteria 7294
104 Ga0207675_100029671 3300026118 Bacteria 5093
105 Ga0207683_10021301 3300026121 Bacteria 5547
106 Ga0207428_10000052 3300027907 Bacteria 176270
107 Ga0207428_10001255 3300027907 Bacteria 27154
108 Ga0207428_10019364 3300027907 Bacteria 5804
109 Ga0268264_10046699 3300028381 Bacteria 3597
110 Ga0268264_10055336 3300028381 Bacteria 3315
111 Ga0307408_100035488 3300031548 Bacteria 3499
112 Ga0307412_10024755 3300031911 Bacteria 3709
113 Ga0373951_0000969 3300035091 Bacteria 7731
114 Ga0495630_0080571 3300046517 Unclassified 2456
115 Ga0495663_0000122 3300046525 Bacteria 32201
116 Ga0495598_0000871 3300046537 Bacteria 5813
117 Ga0495621_0000180 3300046539 Bacteria 14434
118 Ga0495599_0026668 3300046678 Unclassified 3622
119 Ga0495684_0021115 3300047471 Bacteria 5016
120 Ga0496104_0008874 3300048907 Bacteria 8937
121 Ga0496107_0025591 3300048910 Unclassified 4179
122 Ga0496108_0026176 3300048911 Unclassified 4811
123 Ga0496109_0011373 3300048912 Bacteria 7647
124 Ga0496112_0000269 3300048915 Bacteria 33513
125 Ga0501292_000593 3300049515 Bacteria 4443
126 Ga0501292_003663 3300049515 Bacteria 2065
127 Ga0501299_000639 3300049522 Bacteria 4173
128 Ga0501036_0011934 3300049572 Bacteria 7203
129 Ga0501038_0086598 3300049574 Bacteria 2632
130 Ga0501040_0002805 3300049576 Bacteria 11237
131 Ga0501042_0044063 3300049578 Bacteria 3179
132 Ga0501042_0059591 3300049578 Unclassified 2726
133 Ga0501048_0016436 3300049582 Bacteria 5454
134 Ga0501048_0030732 3300049582 Bacteria 3887
135 Ga0501071_0011053 3300049587 Bacteria 6065
136 Ga0501071_0031025 3300049587 Unclassified 3785
137 Ga0501072_0004624 3300049588 Bacteria 10484
138 Ga0501075_0006218 3300049591 Bacteria 8209
139 Ga0501076_0001843 3300049592 Bacteria 14416
140 Ga0501076_0009188 3300049592 Bacteria 7288
141 Ga0501077_0034944 3300049593 Unclassified 3200
142 Ga0501225_0004710 3300049705 Bacteria 4045
143 Ga0501079_0012454 3300049741 Bacteria 6491
144 Ga0501080_0016066 3300049742 Bacteria 6909
145 nmdc:mga00v17_23787_c1 3300050491 Bacteria 3548
146 nmdc:mga05p37_130024_c1 3300050507 Bacteria 3090
147 nmdc:mga05p37_1458_c1 3300050507 Bacteria 27488
148 nmdc:mga05p37_148847_c1 3300050507 Unclassified 2865
149 nmdc:mga05p37_190227_c1 3300050507 Bacteria 2492
150 nmdc:mga05p37_74000_c1 3300050507 Bacteria 4193
151 nmdc:mga09592_13709_c1 3300050508 Bacteria 6623
152 nmdc:mga09592_8177_c1 3300050508 Bacteria 8505
153 nmdc:mga0qj67_1450_c1 3300050509 Bacteria 16612
154 nmdc:mga06r32_21333_c1 3300050510 Bacteria 5980
155 nmdc:mga08y16_14_c1 3300050511 Bacteria 398067
156 nmdc:mga08y16_157574_c1 3300050511 Bacteria 2360
157 nmdc:mga08y16_35320_c1 3300050511 Bacteria 5249
158 nmdc:mga08y16_41725_c2 3300050511 Bacteria 2456
159 nmdc:mga08y16_516_c1 3300050511 Bacteria 35677
160 nmdc:mga08y16_73_c1 3300050511 Bacteria 84090
161 nmdc:mga0n895_45638_c1 3300050512 Bacteria 4276
162 Ga0500568_0026874 3300053139 Unclassified 2411
163 Ga0501084_0022381 3300054114 Bacteria 5273
164 Ga0501082_0012299 3300060353 Bacteria 7354
165 Ga0530510_0002616 3300061734 Bacteria 12385
166 Ga0496112_0107335
167 JGI24751J29686_10000111
168 Ga0065712_10003021
169 Ga0065712_10007876
170 Ga0065712_10068702
171 Ga0065712_10069197
172 Ga0065715_10090238
173 Ga0065715_10099519
174 Ga0070683_100011903
175 Ga0070690_100015857
176 Ga0070670_100000216
177 Ga0070670_100020552
178 Ga0070666_10024840
179 Ga0070675_100000029
180 Ga0070675_100034542
181 Ga0070671_100076923
182 Ga0070674_100001874
183 Ga0070673_100019970
184 Ga0070667_100040164
185 Ga0070703_10002447
186 Ga0070705_100004886
187 Ga0070705_100011654
188 Ga0070700_100000056
189 Ga0070700_100035814
190 Ga0070699_100001524
191 Ga0070684_100001241
192 Ga0070686_100002047
193 Ga0070686_100002219
194 Ga0070686_100040435
195 Ga0070664_100008634
196 Ga0070664_100016331
197 Ga0068857_100014852
198 Ga0070702_100006219
199 Ga0068859_100047352
200 Ga0068864_100006963
201 Ga0068861_100009769
202 Ga0068861_100018298
203 Ga0068863_100055720
204 Ga0068858_100014323
205 Ga0068860_100053709
206 Ga0081455_10037098
207 Ga0075365_10015609
208 Ga0075428_100000014
209 Ga0075428_100008217
210 Ga0075428_100009380
211 Ga0075428_100042470
212 Ga0075428_100048496
213 Ga0075430_100018036
214 Ga0075431_100100955
215 Ga0075434_100047380
216 Ga0075429_100013783
217 Ga0075429_100023763
218 Ga0097620_100029070
219 Ga0097620_100037966
220 Ga0097620_100047350
221 Ga0075435_100006683
222 Ga0075435_100047461
223 Ga0111539_10000391
224 Ga0111539_10016714
225 Ga0111539_10023223
226 Ga0111539_10028211
227 Ga0105247_10005370
228 Ga0114129_10001461
229 Ga0114129_10114441
230 Ga0105242_10000012
231 Ga0105248_10010232
232 Ga0105248_10033210
233 Ga0105248_10109890
234 Ga0105237_10000199
235 Ga0157375_10000021
236 Ga0163163_10000250
237 Ga0163163_10051509
238 Ga0157380_10035690
239 Ga0207697_10000638
240 Ga0207653_10000997
241 Ga0207645_10004910
242 Ga0207643_10017654
243 Ga0207671_10001695
244 Ga0207662_10001717
245 Ga0207681_10027790
246 Ga0207650_10000269
247 Ga0207650_10025545
248 Ga0207659_10000073
249 Ga0207659_10013247
250 Ga0207659_10079224
251 Ga0207700_10018061
252 Ga0207709_10000029
253 Ga0207669_10002070
254 Ga0207691_10018168
255 Ga0207711_10002981
256 Ga0207711_10011272
257 Ga0207711_10016477
258 Ga0207711_10029487
259 Ga0207689_10003739
260 Ga0207661_10037798
261 Ga0207651_10058299
262 Ga0207677_10043360
263 Ga0207708_10000042
264 Ga0207641_10013178
265 Ga0207676_10069992
266 Ga0207674_10022360
267 Ga0207675_100007496
268 Ga0207675_100014724
269 Ga0207675_100029671
270 Ga0207683_10021301
271 Ga0207428_10000052
272 Ga0207428_10001255
273 Ga0207428_10019364
274 Ga0268264_10046699
275 Ga0268264_10055336
276 Ga0307408_100035488
277 Ga0307412_10024755
278 Ga0373951_0000969
279 Ga0495630_0080571
280 Ga0495663_0000122
281 Ga0495598_0000871
282 Ga0495621_0000180
283 Ga0495599_0026668
284 Ga0495684_0021115
285 Ga0496104_0008874
286 Ga0496107_0025591
287 Ga0496108_0026176
288 Ga0496109_0011373
289 Ga0496112_0000269
290 Ga0501292_000593
291 Ga0501292_003663
292 Ga0501299_000639
293 Ga0501036_0011934
294 Ga0501038_0086598
295 Ga0501040_0002805
296 Ga0501042_0044063
297 Ga0501042_0059591
298 Ga0501048_0016436
299 Ga0501048_0030732
300 Ga0501071_0011053
301 Ga0501071_0031025
302 Ga0501072_0004624
303 Ga0501075_0006218
304 Ga0501076_0001843
305 Ga0501076_0009188
306 Ga0501077_0034944
307 Ga0501225_0004710
308 Ga0501079_0012454
309 Ga0501080_0016066
310 nmdc:mga00v17_23787_c1
311 nmdc:mga05p37_130024_c1
312 nmdc:mga05p37_1458_c1
313 nmdc:mga05p37_148847_c1
314 nmdc:mga05p37_190227_c1
315 nmdc:mga05p37_74000_c1
316 nmdc:mga09592_13709_c1
317 nmdc:mga09592_8177_c1
318 nmdc:mga0qj67_1450_c1
319 nmdc:mga06r32_21333_c1
320 nmdc:mga08y16_14_c1
321 nmdc:mga08y16_157574_c1
322 nmdc:mga08y16_35320_c1
323 nmdc:mga08y16_41725_c2
324 nmdc:mga08y16_516_c1
325 nmdc:mga08y16_73_c1
326 nmdc:mga0n895_45638_c1
327 Ga0500568_0026874
328 Ga0501084_0022381
329 Ga0501082_0012299
330 Ga0530510_0002616

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13570

PQQ_3

PQQ-like domain

562

600

0.96

PF13570

PQQ_3

PQQ-like domain

601

639

0.93

PF01011

PQQ

PQQ enzyme repeat

582

618

0.89

PF13570

PQQ_3

PQQ-like domain

258

309

0.87

PF13646

HEAT_2

HEAT repeats

132

217

0.8

PF13360

PQQ_2

PQQ-like domain

214

392

0.77

PF13360

PQQ_2

PQQ-like domain

431

538

0.7

PF13360

PQQ_2

PQQ-like domain

547

686

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yms-assembly1.cif.gz_B structure and assembly of a b-propeller with nine blades and a new conserved repetitive sequence motif 0.8954 431 516
6tjg-assembly1.cif.gz_A crystal structure of the computationally designed cake8 protein 0.8836 189 585
6tjc-assembly1.cif.gz_A crystal structure of the computationally designed cake3 protein 0.8827 480 585
6tjg-assembly1.cif.gz_A crystal structure of the computationally designed cake8 protein 0.8706 189 585
3hxj-assembly2.cif.gz_C crystal structure of pyrrolo-quinoline quinone (pqq_dh) from methanococcus maripaludis, northeast structural genomics consortium target mrr86 0.8648 311 583
ID Description Score Start End Superfamily
2ymsB00 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.8954 431 516 2.40.10.480
af_Q5RG49_936_1023_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.8895 486 569 2.40.128.630
af_D4A5F5_897_1032_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.8884 429 569 2.40.128.630
af_Q8IHQ8_38_221_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8792 490 564 2.130.10.10
af_Q80WC9_1033_1097_2.40.10.480 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.8778 488 545 2.40.10.480
ID Description Score Start End GO Terms
AF-A0A3C1Q0J7-F1-model_v4 Pyrrolo-quinoline quinone 0.9532 499 585
AF-A0A2I0QK73-F1-model_v4 Serine/threonine protein kinase 0.9335 483 570 GO:0004674
AF-A0A354PHA9-F1-model_v4 Serine/threonine protein kinase 0.9327 491 590 GO:0004674
AF-A0A3C1Q0J7-F1-model_v4 Pyrrolo-quinoline quinone 0.9326 499 585
AF-A0A354P9C0-F1-model_v4 Serine/threonine protein kinase 0.9293 457 585 GO:0004674

Map