F246897

General Info

Members Datasets Scaffolds Average Seq Length
165 114 165 181

Family's Representative Sequence

Representative Sequence 3300046499|Ga0495594_0202821|Ga0495594_0202821_224_850
Length 208
Sequence MACLSAAAISGQAVSESIGGFGDESNSMSTLTEPSRRRLLAKAGLLFNGIVGAILAVPIVRYLLSPITRERKPGYESWLSLGELAQFPQSQTRLATYRNPVVDSSDGQTADLPCWVRNLDGKDFQVFAINCAHLGCPVRWFPQSNLFMCPCHGGVYYADGSNAAGPPPRGLFQYQHKVVDGKLLIKAGEMPTTGSPTAGTHTERPPCA

Samples

Sample ID Description Type Environment
1 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
15 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
16 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
17 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
31 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
43 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
44 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
65 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
66 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
67 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
68 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
71 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
72 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
73 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
74 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
75 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
76 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
77 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
78 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
79 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
80 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
81 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
82 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
83 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
84 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
85 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
86 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
87 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
88 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
89 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
90 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
91 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
92 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
93 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
94 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
95 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
96 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
97 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
98 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
99 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
100 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
101 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
102 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
103 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
104 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
105 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
106 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
107 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
108 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
109 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
110 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
111 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
112 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
113 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
114 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.58
Metatranscriptomes 2.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.61
Nodule 0
Rhizoplane 3.03
Rhizosphere 95.15
Stem 0
Stem Tuber 0
Unclassified 1.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10027208 3300003659 Bacteria 1230
2 Ga0070683_100408051 3300005329 Bacteria 1296
3 Ga0070670_101512731 3300005331 Bacteria 616
4 Ga0070714_100618119 3300005435 Bacteria 1041
5 Ga0070710_10148057 3300005437 Unclassified 1446
6 Ga0070711_100502118 3300005439 Bacteria 1000
7 Ga0070711_100557161 3300005439 Bacteria 952
8 Ga0070708_100011196 3300005445 Bacteria 7295
9 Ga0070708_100031219 3300005445 Bacteria 4610
10 Ga0070708_100881362 3300005445 Unclassified 840
11 Ga0070706_100029081 3300005467 Bacteria 5091
12 Ga0070706_100091667 3300005467 Bacteria 2819
13 Ga0070706_100622487 3300005467 Unclassified 1002
14 Ga0070707_100418440 3300005468 Bacteria 1300
15 Ga0070698_100092733 3300005471 Bacteria 3001
16 Ga0070699_100036232 3300005518 Bacteria 4267
17 Ga0070699_100113830 3300005518 Bacteria 2376
18 Ga0070684_100058040 3300005535 Bacteria 3381
19 Ga0070684_100143670 3300005535 Unclassified 2159
20 Ga0070697_100030626 3300005536 Bacteria 4322
21 Ga0070697_100055242 3300005536 Bacteria 3228
22 Ga0070697_100437439 3300005536 Bacteria 1138
23 Ga0070697_100492932 3300005536 Bacteria 1071
24 Ga0070672_100683451 3300005543 Bacteria 898
25 Ga0070686_100659805 3300005544 Unclassified 830
26 Ga0070695_100687052 3300005545 Unclassified 811
27 Ga0070695_100986080 3300005545 Bacteria 684
28 Ga0068861_100206618 3300005719 Bacteria 1652
29 Ga0068863_100179738 3300005841 Bacteria 2031
30 Ga0068858_100293592 3300005842 Bacteria 1550
31 Ga0081540_1000492 3300005983 Bacteria 38821
32 Ga0081540_1000815 3300005983 Bacteria 28521
33 Ga0070717_10013931 3300006028 Bacteria 6177
34 Ga0070717_10077387 3300006028 Bacteria 2785
35 Ga0070716_100223854 3300006173 Unclassified 1266
36 Ga0070712_100173016 3300006175 Unclassified 1677
37 Ga0097621_100043762 3300006237 Bacteria 3610
38 Ga0068871_100331495 3300006358 Bacteria 1342
39 Ga0075433_10232042 3300006852 Unclassified 1639
40 Ga0075434_100282407 3300006871 Bacteria 1679
41 Ga0075434_100581600 3300006871 Bacteria 1139
42 Ga0075434_100767610 3300006871 Unclassified 981
43 Ga0075436_100047020 3300006914 Bacteria 2976
44 Ga0075436_100789147 3300006914 Unclassified 707
45 Ga0075435_100160781 3300007076 Unclassified 1892
46 Ga0099794_10000946 3300007265 Bacteria 9780
47 Ga0099794_10001467 3300007265 Bacteria 8256
48 Ga0099794_10017873 3300007265 Bacteria 3169
49 Ga0099794_10042758 3300007265 Bacteria 2161
50 Ga0099794_10076385 3300007265 Bacteria 1647
51 Ga0099794_10290013 3300007265 Unclassified 847
52 Ga0099795_10011079 3300007788 Bacteria 2680
53 Ga0099795_10062951 3300007788 Bacteria 1381
54 Ga0099795_10195717 3300007788 Bacteria 851
55 Ga0111539_10049686 3300009094 Bacteria 5000
56 Ga0105245_10000076 3300009098 Bacteria 102308
57 Ga0114129_10081999 3300009147 Bacteria 4483
58 Ga0105241_10248447 3300009174 Bacteria 1507
59 Ga0105248_10013977 3300009177 Bacteria 8832
60 Ga0105238_10206193 3300009551 Bacteria 1942
61 Ga0099796_10046978 3300010159 Bacteria 1484
62 Ga0099796_10111253 3300010159 Unclassified 1043
63 Ga0163162_10319606 3300013306 Unclassified 1685
64 Ga0157375_10152255 3300013308 Bacteria 2449
65 Ga0157375_10311576 3300013308 Bacteria 1738
66 Ga0163163_10036693 3300014325 Bacteria 4763
67 Ga0163163_10059634 3300014325 Bacteria 3776
68 Ga0163163_10264382 3300014325 Bacteria 1771
69 Ga0163163_10921950 3300014325 Unclassified 937
70 Ga0157379_10677624 3300014968 Unclassified 967
71 Ga0157376_10028794 3300014969 Bacteria 4419
72 Ga0157376_10332063 3300014969 Bacteria 1449
73 Ga0207685_10041053 3300025905 Unclassified 1729
74 Ga0207699_10187036 3300025906 Unclassified 1395
75 Ga0207684_10037307 3300025910 Unclassified 4124
76 Ga0207684_10097250 3300025910 Bacteria 2513
77 Ga0207654_10466018 3300025911 Bacteria 888
78 Ga0207693_10316061 3300025915 Unclassified 1223
79 Ga0207663_10126420 3300025916 Unclassified 1759
80 Ga0207663_10520455 3300025916 Unclassified 926
81 Ga0207646_11063346 3300025922 Unclassified 713
82 Ga0207694_10200612 3300025924 Bacteria 1623
83 Ga0207687_10000104 3300025927 Bacteria 61420
84 Ga0207700_10028645 3300025928 Unclassified 3920
85 Ga0207700_10064844 3300025928 Unclassified 2784
86 Ga0207700_10330023 3300025928 Bacteria 1324
87 Ga0207664_10133351 3300025929 Unclassified 2093
88 Ga0207664_10852710 3300025929 Unclassified 819
89 Ga0207644_10220364 3300025931 Bacteria 1504
90 Ga0207665_10012955 3300025939 Bacteria 5484
91 Ga0207665_10073852 3300025939 Bacteria 2333
92 Ga0207691_10041308 3300025940 Bacteria 4259
93 Ga0207711_10052090 3300025941 Bacteria 3507
94 Ga0207668_10428047 3300025972 Bacteria 1125
95 Ga0207708_10198695 3300026075 Unclassified 1599
96 Ga0207648_10249052 3300026089 Bacteria 1584
97 Ga0209179_1012283 3300027512 Unclassified 1535
98 Ga0209588_1006084 3300027671 Bacteria 3487
99 Ga0209588_1073109 3300027671 Unclassified 1108
100 Ga0207428_10073257 3300027907 Bacteria 2687
101 Ga0265354_1000010 3300028016 Bacteria 29992
102 Ga0265762_1005675 3300030760 Unclassified 2240
103 Ga0265770_1000949 3300030878 Unclassified 4012
104 Ga0265765_1001176 3300030879 Bacteria 2347
105 Ga0265760_10041957 3300031090 Unclassified 1365
106 Ga0265339_10047078 3300031249 Bacteria 2369
107 Ga0265316_10346825 3300031344 Bacteria 1075
108 Ga0307508_10028066 3300031616 Bacteria 5092
109 Ga0265314_10219186 3300031711 Bacteria 1112
110 Ga0373959_0081532 3300034820 Bacteria 746
111 Ga0373923_0322502 3300035111 Unclassified 734
112 Ga0373954_0488824 3300035118 Unclassified 610
113 Ga0373955_0587139 3300035172 Unclassified 682
114 Ga0373927_0511042 3300035695 Unclassified 794
115 Ga0373937_0187518 3300036401 Bacteria 1943
116 Ga0373937_0317401 3300036401 Bacteria 1474
117 Ga0436364_0552901 3300037853 Bacteria 34158
118 Ga0453683_0338722 3300044673 Bacteria 965
119 Ga0495592_0091881 3300046454 Bacteria 2176
120 Ga0495651_0014130 3300046462 Bacteria 6172
121 Ga0495653_0122585 3300046463 Bacteria 1850
122 Ga0495580_0006958 3300046472 Bacteria 9123
123 Ga0495580_0093468 3300046472 Unclassified 2093
124 Ga0495662_0157929 3300046476 Unclassified 1117
125 Ga0495664_0048690 3300046477 Unclassified 2516
126 Ga0495594_0202821 3300046499 Bacteria 1130
127 Ga0495630_0237736 3300046517 Bacteria 1392
128 Ga0495665_0037578 3300046531 Bacteria 2584
129 Ga0495587_0107512 3300046536 Bacteria 1604
130 Ga0495645_0001288 3300046543 Bacteria 17094
131 Ga0495645_0042699 3300046543 Unclassified 3306
132 Ga0495667_0003777 3300046559 Bacteria 10173
133 Ga0495667_0033453 3300046559 Bacteria 3441
134 Ga0495634_0254107 3300046642 Bacteria 1074
135 Ga0495657_0244589 3300046675 Bacteria 1082
136 Ga0495599_0085721 3300046678 Bacteria 1967
137 Ga0495599_0547236 3300046678 Unclassified 678
138 Ga0495623_0002091 3300046679 Bacteria 13341
139 Ga0495623_0015401 3300046679 Unclassified 4943
140 Ga0495600_0146184 3300046809 Bacteria 1532
141 Ga0495604_0031850 3300047317 Bacteria 4181
142 Ga0495674_0000563 3300047319 Bacteria 34541
143 Ga0495680_0152996 3300047322 Bacteria 1680
144 Ga0495675_0004094 3300047444 Bacteria 8835
145 Ga0495675_0013616 3300047444 Bacteria 5139
146 Ga0495684_0000750 3300047471 Bacteria 26139
147 Ga0495684_0005681 3300047471 Bacteria 9713
148 Ga0495684_0701888 3300047471 Unclassified 671
149 Ga0495602_0013443 3300048088 Bacteria 8367
150 Ga0496104_0792162 3300048907 Unclassified 854
151 Ga0496104_1217555 3300048907 Unclassified 656
152 Ga0496111_0008646 3300048914 Bacteria 6752
153 Ga0496115_0027179 3300048918 Bacteria 4473
154 Ga0496115_0263198 3300048918 Unclassified 1418
155 nmdc:mga05p37_1584303_c1 3300050507 Bacteria 646
156 nmdc:mga05p37_2626_c1 3300050507 Bacteria 20921
157 nmdc:mga05p37_649547_c1 3300050507 Bacteria 1181
158 nmdc:mga08y16_38672_c1 3300050511 Bacteria 5008
159 nmdc:mga0n895_145959_c1 3300050512 Bacteria 2395
160 nmdc:mga0n895_274427_c1 3300050512 Bacteria 1710
161 nmdc:mga0n895_832001_c1 3300050512 Unclassified 912
162 nmdc:mga0rr50_29598_c1 3300050513 Unclassified 3865
163 nmdc:mga0a205_4849_c1 3300050515 Bacteria 12095
164 Ga0495619_0817727 3300053085 Unclassified 630
165 Ga0500588_0217046 3300053146 Bacteria 712

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044673 Ga0453683_0338722 Ga0453683_0338722_271_774 166
2 3300035111 Ga0373923_0322502 Ga0373923_0322502_120_626 167
3 3300048907 Ga0496104_0792162 Ga0496104_0792162_309_815 167
4 3300048907 Ga0496104_1217555 Ga0496104_1217555_95_601 167
5 3300005545 Ga0070695_100687052 Ga0070695_1006870522 169
6 3300025916 Ga0207663_10126420 Ga0207663_101264203 169
7 3300034820 Ga0373959_0081532 Ga0373959_0081532_128_643 169
8 3300035118 Ga0373954_0488824 Ga0373954_0488824_70_591 169
9 3300048918 Ga0496115_0263198 Ga0496115_0263198_121_633 169
10 3300014325 Ga0163163_10264382 Ga0163163_102643822 175
11 3300037853 Ga0436364_0552901 Ga0436364_0552901_30282_30827 176
12 3300006871 Ga0075434_100581600 Ga0075434_1005816002 177
13 3300007265 Ga0099794_10001467 Ga0099794_100014678 177
14 3300027671 Ga0209588_1006084 Ga0209588_10060843 177
15 3300050512 nmdc:mga0n895_145959_c1 nmdc:mga0n895_145959_c1_696_1232 177
16 3300007265 Ga0099794_10042758 Ga0099794_100427582 178
17 3300027671 Ga0209588_1073109 Ga0209588_10731092 178
18 3300031249 Ga0265339_10047078 Ga0265339_100470783 178
19 3300031344 Ga0265316_10346825 Ga0265316_103468252 178
20 3300031711 Ga0265314_10219186 Ga0265314_102191862 178
21 3300053146 Ga0500588_0217046 Ga0500588_0217046_79_615 178
22 3300005435 Ga0070714_100618119 Ga0070714_1006181192 179
23 3300005437 Ga0070710_10148057 Ga0070710_101480572 179
24 3300005439 Ga0070711_100557161 Ga0070711_1005571612 179
25 3300005445 Ga0070708_100011196 Ga0070708_1000111965 179
26 3300005445 Ga0070708_100881362 Ga0070708_1008813622 179
27 3300005467 Ga0070706_100622487 Ga0070706_1006224872 179
28 3300005468 Ga0070707_100418440 Ga0070707_1004184402 179
29 3300005518 Ga0070699_100036232 Ga0070699_1000362324 179
30 3300005545 Ga0070695_100986080 Ga0070695_1009860801 179
31 3300005719 Ga0068861_100206618 Ga0068861_1002066182 179
32 3300006028 Ga0070717_10013931 Ga0070717_100139316 179
33 3300006871 Ga0075434_100282407 Ga0075434_1002824073 179
34 3300006914 Ga0075436_100047020 Ga0075436_1000470204 179
35 3300006914 Ga0075436_100789147 Ga0075436_1007891472 179
36 3300007265 Ga0099794_10000946 Ga0099794_1000094611 179
37 3300007265 Ga0099794_10076385 Ga0099794_100763852 179
38 3300007788 Ga0099795_10011079 Ga0099795_100110792 179
39 3300007788 Ga0099795_10062951 Ga0099795_100629511 179
40 3300009094 Ga0111539_10049686 Ga0111539_100496866 179
41 3300009098 Ga0105245_10000076 Ga0105245_1000007637 179
42 3300010159 Ga0099796_10111253 Ga0099796_101112532 179
43 3300013308 Ga0157375_10152255 Ga0157375_101522553 179
44 3300025905 Ga0207685_10041053 Ga0207685_100410532 179
45 3300025906 Ga0207699_10187036 Ga0207699_101870362 179
46 3300025915 Ga0207693_10316061 Ga0207693_103160612 179
47 3300025922 Ga0207646_11063346 Ga0207646_110633462 179
48 3300025927 Ga0207687_10000104 Ga0207687_1000010446 179
49 3300025928 Ga0207700_10064844 Ga0207700_100648443 179
50 3300025929 Ga0207664_10133351 Ga0207664_101333512 179
51 3300025931 Ga0207644_10220364 Ga0207644_102203642 179
52 3300025939 Ga0207665_10073852 Ga0207665_100738522 179
53 3300025972 Ga0207668_10428047 Ga0207668_104280472 179
54 3300026089 Ga0207648_10249052 Ga0207648_102490522 179
55 3300027512 Ga0209179_1012283 Ga0209179_10122832 179
56 3300027907 Ga0207428_10073257 Ga0207428_100732572 179
57 3300028016 Ga0265354_1000010 Ga0265354_100001025 179
58 3300030760 Ga0265762_1005675 Ga0265762_10056752 179
59 3300030878 Ga0265770_1000949 Ga0265770_10009494 179
60 3300030879 Ga0265765_1001176 Ga0265765_10011762 179
61 3300031090 Ga0265760_10041957 Ga0265760_100419572 179
62 3300048914 Ga0496111_0008646 Ga0496111_0008646_4121_4666 179
63 3300048918 Ga0496115_0027179 Ga0496115_0027179_3839_4384 179
64 3300050507 nmdc:mga05p37_649547_c1 nmdc:mga05p37_649547_c1_292_834 179
65 3300050511 nmdc:mga08y16_38672_c1 nmdc:mga08y16_38672_c1_4018_4560 179
66 3300050512 nmdc:mga0n895_274427_c1 nmdc:mga0n895_274427_c1_358_900 179
67 3300005329 Ga0070683_100408051 Ga0070683_1004080511 180
68 3300005331 Ga0070670_101512731 Ga0070670_1015127311 180
69 3300005445 Ga0070708_100031219 Ga0070708_1000312192 180
70 3300005467 Ga0070706_100029081 Ga0070706_1000290816 180
71 3300005467 Ga0070706_100091667 Ga0070706_1000916672 180
72 3300005471 Ga0070698_100092733 Ga0070698_1000927332 180
73 3300005518 Ga0070699_100113830 Ga0070699_1001138303 180
74 3300005535 Ga0070684_100058040 Ga0070684_1000580403 180
75 3300005535 Ga0070684_100143670 Ga0070684_1001436703 180
76 3300005536 Ga0070697_100030626 Ga0070697_1000306263 180
77 3300005536 Ga0070697_100055242 Ga0070697_1000552422 180
78 3300005536 Ga0070697_100437439 Ga0070697_1004374391 180
79 3300005536 Ga0070697_100492932 Ga0070697_1004929322 180
80 3300005543 Ga0070672_100683451 Ga0070672_1006834511 180
81 3300005544 Ga0070686_100659805 Ga0070686_1006598051 180
82 3300005841 Ga0068863_100179738 Ga0068863_1001797382 180
83 3300005842 Ga0068858_100293592 Ga0068858_1002935922 180
84 3300006028 Ga0070717_10077387 Ga0070717_100773872 180
85 3300006173 Ga0070716_100223854 Ga0070716_1002238542 180
86 3300006175 Ga0070712_100173016 Ga0070712_1001730162 180
87 3300006237 Ga0097621_100043762 Ga0097621_1000437624 180
88 3300006358 Ga0068871_100331495 Ga0068871_1003314952 180
89 3300006852 Ga0075433_10232042 Ga0075433_102320422 180
90 3300006871 Ga0075434_100767610 Ga0075434_1007676102 180
91 3300007076 Ga0075435_100160781 Ga0075435_1001607813 180
92 3300007265 Ga0099794_10017873 Ga0099794_100178734 180
93 3300007265 Ga0099794_10290013 Ga0099794_102900132 180
94 3300007788 Ga0099795_10195717 Ga0099795_101957172 180
95 3300009147 Ga0114129_10081999 Ga0114129_100819992 180
96 3300009174 Ga0105241_10248447 Ga0105241_102484472 180
97 3300009177 Ga0105248_10013977 Ga0105248_100139775 180
98 3300009551 Ga0105238_10206193 Ga0105238_102061932 180
99 3300010159 Ga0099796_10046978 Ga0099796_100469781 180
100 3300013306 Ga0163162_10319606 Ga0163162_103196062 180
101 3300013308 Ga0157375_10311576 Ga0157375_103115762 180
102 3300014325 Ga0163163_10036693 Ga0163163_100366933 180
103 3300014325 Ga0163163_10059634 Ga0163163_100596342 180
104 3300014325 Ga0163163_10921950 Ga0163163_109219502 180
105 3300014968 Ga0157379_10677624 Ga0157379_106776241 180
106 3300014969 Ga0157376_10028794 Ga0157376_100287945 180
107 3300014969 Ga0157376_10332063 Ga0157376_103320632 180
108 3300025910 Ga0207684_10037307 Ga0207684_100373076 180
109 3300025910 Ga0207684_10097250 Ga0207684_100972502 180
110 3300025911 Ga0207654_10466018 Ga0207654_104660181 180
111 3300025916 Ga0207663_10520455 Ga0207663_105204551 180
112 3300025924 Ga0207694_10200612 Ga0207694_102006121 180
113 3300025928 Ga0207700_10028645 Ga0207700_100286455 180
114 3300025928 Ga0207700_10330023 Ga0207700_103300232 180
115 3300025929 Ga0207664_10852710 Ga0207664_108527102 180
116 3300025939 Ga0207665_10012955 Ga0207665_100129553 180
117 3300025940 Ga0207691_10041308 Ga0207691_100413082 180
118 3300025941 Ga0207711_10052090 Ga0207711_100520903 180
119 3300026075 Ga0207708_10198695 Ga0207708_101986952 180
120 3300031616 Ga0307508_10028066 Ga0307508_100280666 180
121 3300035172 Ga0373955_0587139 Ga0373955_0587139_126_671 180
122 3300035695 Ga0373927_0511042 Ga0373927_0511042_112_657 180
123 3300036401 Ga0373937_0187518 Ga0373937_0187518_249_794 180
124 3300036401 Ga0373937_0317401 Ga0373937_0317401_324_869 180
125 3300046454 Ga0495592_0091881 Ga0495592_0091881_1230_1775 180
126 3300046462 Ga0495651_0014130 Ga0495651_0014130_3861_4406 180
127 3300046463 Ga0495653_0122585 Ga0495653_0122585_497_1042 180
128 3300046472 Ga0495580_0006958 Ga0495580_0006958_2687_3232 180
129 3300046472 Ga0495580_0093468 Ga0495580_0093468_1048_1593 180
130 3300046476 Ga0495662_0157929 Ga0495662_0157929_318_863 180
131 3300046477 Ga0495664_0048690 Ga0495664_0048690_172_717 180
132 3300046499 Ga0495594_0202821 Ga0495594_0202821_224_850 180
133 3300046517 Ga0495630_0237736 Ga0495630_0237736_339_884 180
134 3300046531 Ga0495665_0037578 Ga0495665_0037578_1829_2374 180
135 3300046536 Ga0495587_0107512 Ga0495587_0107512_715_1260 180
136 3300046543 Ga0495645_0001288 Ga0495645_0001288_11326_11871 180
137 3300046543 Ga0495645_0042699 Ga0495645_0042699_607_1152 180
138 3300046559 Ga0495667_0003777 Ga0495667_0003777_6361_6906 180
139 3300046559 Ga0495667_0033453 Ga0495667_0033453_2415_2960 180
140 3300046642 Ga0495634_0254107 Ga0495634_0254107_421_966 180
141 3300046675 Ga0495657_0244589 Ga0495657_0244589_366_992 180
142 3300046678 Ga0495599_0085721 Ga0495599_0085721_83_628 180
143 3300046678 Ga0495599_0547236 Ga0495599_0547236_45_590 180
144 3300046679 Ga0495623_0002091 Ga0495623_0002091_1334_1879 180
145 3300046679 Ga0495623_0015401 Ga0495623_0015401_2957_3502 180
146 3300046809 Ga0495600_0146184 Ga0495600_0146184_333_878 180
147 3300047317 Ga0495604_0031850 Ga0495604_0031850_2130_2675 180
148 3300047319 Ga0495674_0000563 Ga0495674_0000563_17997_18542 180
149 3300047322 Ga0495680_0152996 Ga0495680_0152996_713_1258 180
150 3300047444 Ga0495675_0004094 Ga0495675_0004094_7166_7711 180
151 3300047444 Ga0495675_0013616 Ga0495675_0013616_2606_3151 180
152 3300047471 Ga0495684_0000750 Ga0495684_0000750_15855_16400 180
153 3300047471 Ga0495684_0005681 Ga0495684_0005681_3429_3974 180
154 3300047471 Ga0495684_0701888 Ga0495684_0701888_111_656 180
155 3300048088 Ga0495602_0013443 Ga0495602_0013443_7678_8304 180
156 3300050507 nmdc:mga05p37_1584303_c1 nmdc:mga05p37_1584303_c1_91_636 180
157 3300050507 nmdc:mga05p37_2626_c1 nmdc:mga05p37_2626_c1_16598_17143 180
158 3300050512 nmdc:mga0n895_832001_c1 nmdc:mga0n895_832001_c1_19_564 180
159 3300050513 nmdc:mga0rr50_29598_c1 nmdc:mga0rr50_29598_c1_1474_2019 180
160 3300050515 nmdc:mga0a205_4849_c1 nmdc:mga0a205_4849_c1_2262_2807 180
161 3300053085 Ga0495619_0817727 Ga0495619_0817727_49_594 180
162 3300003659 JGI25404J52841_10027208 JGI25404J52841_100272082 181
163 3300005439 Ga0070711_100502118 Ga0070711_1005021182 181
164 3300005983 Ga0081540_1000492 Ga0081540_100049238 181
165 3300005983 Ga0081540_1000815 Ga0081540_10008154 181

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00355

Rieske

Rieske [2Fe-2S] domain

78

175

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rfs-assembly1.cif.gz_A rieske soluble fragment from spinach 0.747 56 158
8hn2-assembly1.cif.gz_B selenomethionine-labelled soluble domain of rieske iron-sulfur protein from chlorobaculum tepidum 0.7356 49 157
5cxm-assembly2.cif.gz_D crystal structure of the cyanobacterial plasma membrane rieske protein petc3 from synechocystis pcc 6803 0.6899 51 159
1q90-assembly1.cif.gz_C structure of the cytochrome b6f (plastohydroquinone : plastocyanin oxidoreductase) from chlamydomonas reinhardtii 0.6869 56 167
5cxm-assembly2.cif.gz_D crystal structure of the cyanobacterial plasma membrane rieske protein petc3 from synechocystis pcc 6803 0.679 51 159
ID Description Score Start End Superfamily
3gkqC02 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.8048 50 161 2.20.25.680
3gkqC02 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.7661 50 161 2.20.25.680
2e76D02 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.7161 56 164 2.102.10.10
1vf5D02 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.7078 85 164 2.102.10.10
5cxmD00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.6899 51 159 2.102.10.10
ID Description Score Start End GO Terms
AF-A0A535JHW0-F1-model_v4 Ubiquinol-cytochrome c reductase iron-sulfur subunit 0.8963 48 164 GO:0016020
GO:0046872
GO:0051537
AF-A0A402CTN1-F1-model_v4 Uncharacterized protein 0.8724 50 158 GO:0016020
GO:0046872
GO:0051537
AF-A0A3L7TSA9-F1-model_v4 Rieske domain-containing protein 0.8568 68 165 GO:0016020
GO:0046872
GO:0051537
AF-A0A2D7E380-F1-model_v4 deleted 0.8406 33 163
AF-A0A5C4YBY0-F1-model_v4 Rieske 2Fe-2S domain-containing protein 0.8354 86 167 GO:0016020
GO:0046872
GO:0051537

Feature Viewer

pLDDT pTM Quality
79.61 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map