F246772

General Info

Members Datasets Scaffolds Average Seq Length
165 116 137 269

Family's Representative Sequence

Representative Sequence 3300044658|Ga0466972_0039522|Ga0466972_0039522_748_1617
Length 289
Sequence MASGAVGTVTRGTTNTNRLRRVDRWIASLPLLRRTPDPLVVDLGYGASGVTALELQQRLAKARADVEVVGLEIEPGRVRTAEEQLAEVRAGRTSFDPAARIRFAVGGFEVPLPEGRRAAVIRAFNVLRQYDESEVAAAWDRMLARLQPDGLLVEGTCDEIGRISSWIALGSEGPRSFTVSLRLTGLEAPSIVAERLPKALIHRNVPGERVHAFLADLDRLWRIHSPLAAYGPRQRWIAAAQGMREAGWPVIGGRSRWRLGELTVAWEAVAPVTPPPATATAATGSTGRR

Samples

Sample ID Description Type Environment
1 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
2 2643221553 Microbacterium sp. Root553 Isolate Unclassified
3 2643221566 Microbacterium sp. Root166 Isolate Unclassified
4 2643221630 Microbacterium sp. Root322 Isolate Unclassified
5 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
6 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
7 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
8 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
9 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
10 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
11 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
12 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
13 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
14 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
15 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
16 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
17 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
18 2919395869 Microbacterium resistens 2980 Isolate Unclassified
19 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
20 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
21 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
22 2928153084 Leifsonia sp. 563 Isolate Unclassified
23 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
24 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
25 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
26 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
27 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
28 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
29 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
30 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
31 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
32 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
33 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
34 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
35 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
36 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
52 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
56 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
62 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
63 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
64 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
65 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
66 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
67 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
68 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
69 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
70 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
71 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
72 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
73 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
74 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
75 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
76 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
77 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
78 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
79 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
80 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
81 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
82 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
83 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
84 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
85 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
86 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
87 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
88 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
89 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
90 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
91 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
92 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
93 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
94 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
95 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
96 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
97 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
98 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
99 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
106 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
107 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
109 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
110 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
111 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
112 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
113 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
114 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
115 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
116 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.61
Metatranscriptomes 2.42
Isolates 16.97

Biome Distribution

Category Percentage (%)
Aerial Root 0.61
Bulb 0
Endosphere 17.58
Nodule 0
Rhizoplane 3.03
Rhizosphere 50.91
Stem 0
Stem Tuber 0
Unclassified 27.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000332 3300003214 Bacteria 56112
2 rootH1_10075901 3300003323 Bacteria 1424
3 Ga0006562J51391_1008124 3300003578 Bacteria 25634
4 Ga0006562J51391_1008125 3300003578 Bacteria 24266
5 Ga0055539_1000005 3300003752 Bacteria 609598
6 Ga0055533_1000001 3300003756 Bacteria 1863437
7 Ga0055525_1000290 3300003759 Bacteria 45300
8 Ga0055527_1000017 3300003760 Bacteria 242362
9 Ga0055542_1000044 3300003762 Bacteria 206982
10 Ga0055529_1000093 3300003763 Bacteria 137160
11 Ga0055541_1005977 3300003841 Bacteria 2100
12 Ga0070683_100001774 3300005329 Bacteria 16799
13 Ga0070684_100001308 3300005535 Bacteria 17848
14 Ga0070664_100124783 3300005564 Bacteria 2257
15 Ga0068857_100172859 3300005577 Bacteria 1964
16 Ga0075363_100176807 3300006048 Bacteria 1213
17 Ga0075364_10227017 3300006051 Bacteria 1268
18 Ga0157369_10022781 3300013105 Bacteria 6985
19 Ga0157369_10063810 3300013105 Bacteria 3968
20 Ga0157369_10207577 3300013105 Bacteria 2054
21 Ga0157372_10363045 3300013307 Bacteria 1688
22 Ga0157372_10527938 3300013307 Bacteria 1376
23 Ga0157372_10814847 3300013307 Bacteria 1084
24 Ga0206354_10149218 3300020081 Bacteria 1894
25 Ga0206353_10064343 3300020082 Bacteria 2440
26 Ga0209566_100053 3300025225 Bacteria 224436
27 Ga0209674_100001 3300025226 Bacteria 4013750
28 Ga0209672_100039 3300025228 Bacteria 283064
29 Ga0209147_100651 3300025229 Bacteria 18119
30 Ga0209563_100001 3300025230 Bacteria 4013775
31 Ga0209563_100314 3300025230 Bacteria 19197
32 Ga0207427_100042 3300025231 Bacteria 254170
33 Ga0209258_100996 3300025242 Bacteria 13076
34 Ga0209677_100001 3300025253 Bacteria 4013787
35 Ga0209677_100767 3300025253 Bacteria 16274
36 Ga0209148_1000004 3300025254 Bacteria 1844481
37 Ga0209233_1000001 3300025261 Bacteria 2992747
38 Ga0209455_1000117 3300025272 Bacteria 176940
39 Ga0209455_1001672 3300025272 Bacteria 9560
40 Ga0207649_10373826 3300025920 Bacteria 1061
41 Ga0207661_10002700 3300025944 Bacteria 12201
42 Ga0207679_10046206 3300025945 Bacteria 3155
43 Ga0207674_10103988 3300026116 Bacteria 2819
44 Ga0307515_10288905 3300028794 Bacteria 1338
45 Ga0265327_10001855 3300031251 Bacteria 24510
46 Ga0265327_10007027 3300031251 Bacteria 8824
47 Ga0307405_10037273 3300031731 Bacteria 2921
48 Ga0307413_10003007 3300031824 Bacteria 6997
49 Ga0307406_10092255 3300031901 Bacteria 2042
50 Ga0307406_10163707 3300031901 Bacteria 1602
51 Ga0307409_100372217 3300031995 Bacteria 1355
52 Ga0395899_0001710 3300037312 Bacteria 18277
53 Ga0395899_0090991 3300037312 Bacteria 2211
54 Ga0395900_0001961 3300037418 Bacteria 23236
55 Ga0395900_0114607 3300037418 Bacteria 2766
56 Ga0395898_0000256 3300037466 Bacteria 130878
57 Ga0395898_0129715 3300037466 Bacteria 2415
58 Ga0466972_0039522 3300044658 Bacteria 2302
59 Ga0466972_0041847 3300044658 Bacteria 2229
60 Ga0466972_0117253 3300044658 Bacteria 1256
61 Ga0466965_0082261 3300044683 Bacteria 1628
62 Ga0466961_0068466 3300044693 Bacteria 2254
63 Ga0466961_0156727 3300044693 Bacteria 1420
64 Ga0466968_0031131 3300044735 Bacteria 2212
65 Ga0466968_0032127 3300044735 Bacteria 2182
66 Ga0466970_0061562 3300044765 Bacteria 2011
67 Ga0466970_0106217 3300044765 Bacteria 1531
68 Ga0466970_0109307 3300044765 Bacteria 1509
69 Ga0466957_0088438 3300044842 Bacteria 1938
70 Ga0466960_0050861 3300044901 Bacteria 1999
71 Ga0466959_0012663 3300045049 Bacteria 6100
72 Ga0466958_0309853 3300045836 Bacteria 1014
73 Ga0495627_001242 3300046453 Bacteria 15867
74 Ga0495590_0000119 3300046457 Bacteria 47435
75 Ga0495631_0106338 3300046518 Bacteria 1207
76 Ga0495609_0126446 3300046538 Bacteria 1097
77 Ga0495686_0223270 3300047472 Bacteria 1071
78 Ga0495686_0229829 3300047472 Bacteria 1051
79 Ga0495626_0003878 3300048091 Bacteria 9376
80 Ga0496100_0235320 3300048903 Bacteria 1349
81 Ga0496109_0233680 3300048912 Bacteria 1730
82 Ga0496113_0275127 3300048916 Bacteria 1346
83 Ga0496114_0131877 3300048917 Bacteria 2158
84 Ga0496115_0019652 3300048918 Bacteria 5200
85 Ga0496117_0000726 3300048920 Bacteria 51736
86 Ga0496117_0008944 3300048920 Bacteria 9429
87 Ga0496117_0009141 3300048920 Bacteria 9293
88 Ga0496117_0047380 3300048920 Bacteria 3082
89 Ga0496117_0076658 3300048920 Bacteria 2215
90 Ga0496117_0101074 3300048920 Bacteria 1825
91 Ga0496117_0203991 3300048920 Bacteria 1115
92 Ga0496118_0000173 3300048921 Bacteria 116057
93 Ga0496118_0051220 3300048921 Bacteria 3160
94 Ga0496119_0003077 3300048922 Bacteria 17612
95 Ga0496119_0050783 3300048922 Bacteria 2553
96 Ga0496119_0201228 3300048922 Bacteria 1031
97 Ga0496119_0241834 3300048922 Bacteria 914
98 Ga0496121_0209328 3300048924 Bacteria 1383
99 Ga0496122_0000420 3300048925 Bacteria 89921
100 Ga0496122_0019490 3300048925 Bacteria 6193
101 Ga0496122_0128407 3300048925 Bacteria 1617
102 Ga0496122_0263362 3300048925 Bacteria 955
103 Ga0496123_0000354 3300048926 Bacteria 86153
104 Ga0496123_0033158 3300048926 Bacteria 3722
105 Ga0496124_0000135 3300048927 Bacteria 152458
106 Ga0496124_0002851 3300048927 Bacteria 21850
107 Ga0496124_0098007 3300048927 Bacteria 2379
108 Ga0496124_0114339 3300048927 Bacteria 2167
109 Ga0496124_0123015 3300048927 Bacteria 2070
110 Ga0496124_0268895 3300048927 Bacteria 1250
111 Ga0496125_0001305 3300048928 Bacteria 36944
112 Ga0496125_0010731 3300048928 Bacteria 9230
113 Ga0496126_0012712 3300048929 Bacteria 8610
114 Ga0496126_0133911 3300048929 Bacteria 2139
115 Ga0496126_0155479 3300048929 Bacteria 1957
116 Ga0501034_0001844 3300049571 Bacteria 26913
117 Ga0501034_0016635 3300049571 Bacteria 7542
118 Ga0501034_0043883 3300049571 Bacteria 4522
119 Ga0501034_0278496 3300049571 Bacteria 1612
120 Ga0501034_0748867 3300049571 Bacteria 872
121 Ga0501036_0503089 3300049572 Bacteria 1008
122 Ga0501037_0055287 3300049573 Bacteria 2902
123 Ga0501038_0405347 3300049574 Bacteria 1054
124 Ga0501046_0031887 3300049580 Bacteria 4269
125 Ga0501047_0021425 3300049581 Bacteria 6205
126 Ga0501070_0000472 3300049586 Bacteria 36579
127 Ga0501070_0707322 3300049586 Bacteria 796
128 Ga0501080_0587258 3300049742 Bacteria 990
129 Ga0501035_0001199 3300049822 Bacteria 27008
130 Ga0501035_0073796 3300049822 Bacteria 3019
131 Ga0501035_0093313 3300049822 Bacteria 2648
132 Ga0501044_0000954 3300049823 Bacteria 34722
133 nmdc:mga03n38_159711_c1 3300050490 Bacteria 1140
134 nmdc:mga00v17_2726_c1 3300050491 Bacteria 9067
135 nmdc:mga0sz30_31792_c1 3300050516 Bacteria 2185
136 Ga0500568_0011745 3300053139 Bacteria 4047
137 Ga0500616_0000089 3300053153 Bacteria 191075

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047472 Ga0495686_0229829 Ga0495686_0229829_32_736 234
2 3300049586 Ga0501070_0707322 Ga0501070_0707322_32_781 245
3 3300031251 Ga0265327_10007027 Ga0265327_100070272 249
4 3300053153 Ga0500616_0000089 Ga0500616_0000089_61640_62413 250
5 3300025920 Ga0207649_10373826 Ga0207649_103738262 251
6 iso_pu_bacteria 2751185788 2753303534 253
7 iso_pu_bacteria 2904430863 2904432552 253
8 iso_pu_bacteria 2904501621 2904501664 253
9 iso_pu_bacteria 2908674828 2908676282 253
10 iso_pu_bacteria 2909074476 2909077166 253
11 iso_pu_bacteria 2919039151 2919041862 253
12 iso_pu_bacteria 2919042368 2919043358 253
13 iso_pu_bacteria 2928104781 2928105627 253
14 iso_pu_bacteria 2928500415 2928500784 253
15 iso_pu_bacteria 2984551494 2984551825 253
16 3300005329 Ga0070683_100001774 Ga0070683_10000177415 254
17 3300005535 Ga0070684_100001308 Ga0070684_10000130823 254
18 3300005564 Ga0070664_100124783 Ga0070664_1001247832 254
19 3300005577 Ga0068857_100172859 Ga0068857_1001728592 254
20 3300013307 Ga0157372_10814847 Ga0157372_108148472 254
21 3300025944 Ga0207661_10002700 Ga0207661_100027009 254
22 3300025945 Ga0207679_10046206 Ga0207679_100462062 254
23 3300026116 Ga0207674_10103988 Ga0207674_101039883 254
24 3300031251 Ga0265327_10001855 Ga0265327_100018552 254
25 3300049572 Ga0501036_0503089 Ga0501036_0503089_89_871 255
26 3300053139 Ga0500568_0011745 Ga0500568_0011745_3189_3956 255
27 3300003323 rootH1_10075901 rootH1_100759012 257
28 3300044765 Ga0466970_0061562 Ga0466970_0061562_48_821 257
29 3300046538 Ga0495609_0126446 Ga0495609_0126446_101_874 257
30 3300048920 Ga0496117_0008944 Ga0496117_0008944_5522_6295 257
31 3300048921 Ga0496118_0000173 Ga0496118_0000173_110949_111722 257
32 3300048922 Ga0496119_0050783 Ga0496119_0050783_1676_2449 257
33 3300048922 Ga0496119_0201228 Ga0496119_0201228_212_985 257
34 3300048925 Ga0496122_0128407 Ga0496122_0128407_96_869 257
35 3300048925 Ga0496122_0263362 Ga0496122_0263362_46_819 257
36 3300048926 Ga0496123_0033158 Ga0496123_0033158_2662_3435 257
37 3300048927 Ga0496124_0000135 Ga0496124_0000135_147338_148111 257
38 3300048927 Ga0496124_0114339 Ga0496124_0114339_303_1076 257
39 3300048927 Ga0496124_0123015 Ga0496124_0123015_697_1470 257
40 3300049571 Ga0501034_0043883 Ga0501034_0043883_3402_4175 257
41 3300049571 Ga0501034_0748867 Ga0501034_0748867_44_817 257
42 3300049742 Ga0501080_0587258 Ga0501080_0587258_65_838 257
43 3300006048 Ga0075363_100176807 Ga0075363_1001768071 258
44 3300028794 Ga0307515_10288905 Ga0307515_102889051 258
45 3300044735 Ga0466968_0032127 Ga0466968_0032127_60_836 258
46 3300046457 Ga0495590_0000119 Ga0495590_0000119_42110_42901 258
47 3300046518 Ga0495631_0106338 Ga0495631_0106338_234_1010 258
48 3300047472 Ga0495686_0223270 Ga0495686_0223270_19_798 258
49 3300048091 Ga0495626_0003878 Ga0495626_0003878_8247_9023 258
50 3300048912 Ga0496109_0233680 Ga0496109_0233680_434_1231 258
51 3300048920 Ga0496117_0101074 Ga0496117_0101074_759_1544 258
52 3300048924 Ga0496121_0209328 Ga0496121_0209328_436_1221 258
53 3300048927 Ga0496124_0098007 Ga0496124_0098007_151_927 258
54 3300049571 Ga0501034_0016635 Ga0501034_0016635_6653_7429 258
55 3300049571 Ga0501034_0278496 Ga0501034_0278496_452_1228 258
56 3300050490 nmdc:mga03n38_159711_c1 nmdc:mga03n38_159711_c1_269_1081 258
57 3300031824 Ga0307413_10003007 Ga0307413_100030077 259
58 3300048922 Ga0496119_0003077 Ga0496119_0003077_13109_13909 259
59 3300049573 Ga0501037_0055287 Ga0501037_0055287_939_1811 260
60 3300049574 Ga0501038_0405347 Ga0501038_0405347_166_1038 260
61 3300049581 Ga0501047_0021425 Ga0501047_0021425_3433_4305 260
62 3300049822 Ga0501035_0001199 Ga0501035_0001199_11214_12086 260
63 3300049823 Ga0501044_0000954 Ga0501044_0000954_11895_12767 260
64 iso_pu_bacteria 2844852863 2844854457 266
65 iso_pu_bacteria 8056037122 8056039249 266
66 iso_pu_bacteria 2928090899 2928091449 267
67 iso_pu_bacteria 8045830549 8045834389 267
68 iso_pu_bacteria 2919395869 2919398061 268
69 iso_pu_bacteria 2643221542 2643732397 269
70 iso_pu_bacteria 2643221553 2643786496 269
71 iso_pu_bacteria 2643221630 2644171217 269
72 iso_pu_bacteria 2844841374 2844843205 269
73 iso_pu_bacteria 2852646457 2852648978 269
74 iso_pu_bacteria 2852663356 2852664265 269
75 iso_pu_bacteria 2857723135 2857724803 269
76 iso_pu_bacteria 2919055335 2919058694 269
77 iso_pu_bacteria 2919523602 2919525279 269
78 iso_pu_bacteria 2928153084 2928153341 269
79 iso_pu_bacteria 2946033335 2946036749 269
80 3300050516 nmdc:mga0sz30_31792_c1 nmdc:mga0sz30_31792_c1_134_955 270
81 3300003760 Ga0055527_1000017 Ga0055527_1000017203 271
82 3300003762 Ga0055542_1000044 Ga0055542_1000044203 271
83 3300003763 Ga0055529_1000093 Ga0055529_100009348 271
84 3300025228 Ga0209672_100039 Ga0209672_100039206 271
85 3300025229 Ga0209147_100651 Ga0209147_10065113 271
86 3300025242 Ga0209258_100996 Ga0209258_1009969 271
87 3300025254 Ga0209148_1000004 Ga0209148_1000004206 271
88 3300025272 Ga0209455_1000117 Ga0209455_100011727 271
89 3300031901 Ga0307406_10163707 Ga0307406_101637072 271
90 3300031995 Ga0307409_100372217 Ga0307409_1003722171 271
91 iso_pu_bacteria 2643221566 2643849012 271
92 3300013105 Ga0157369_10022781 Ga0157369_100227817 272
93 3300013307 Ga0157372_10363045 Ga0157372_103630452 272
94 3300025272 Ga0209455_1001672 Ga0209455_10016727 272
95 3300031731 Ga0307405_10037273 Ga0307405_100372732 272
96 3300037312 Ga0395899_0090991 Ga0395899_0090991_1316_2143 272
97 3300037418 Ga0395900_0001961 Ga0395900_0001961_9386_10213 272
98 3300037466 Ga0395898_0000256 Ga0395898_0000256_101561_102388 272
99 3300048903 Ga0496100_0235320 Ga0496100_0235320_475_1311 272
100 3300048917 Ga0496114_0131877 Ga0496114_0131877_1295_2131 272
101 3300048918 Ga0496115_0019652 Ga0496115_0019652_271_1107 272
102 3300048920 Ga0496117_0047380 Ga0496117_0047380_29_847 272
103 3300048920 Ga0496117_0076658 Ga0496117_0076658_575_1393 272
104 3300048920 Ga0496117_0203991 Ga0496117_0203991_50_886 272
105 3300048922 Ga0496119_0241834 Ga0496119_0241834_53_889 272
106 3300048925 Ga0496122_0000420 Ga0496122_0000420_22319_23158 272
107 3300048926 Ga0496123_0000354 Ga0496123_0000354_72020_72859 272
108 3300048927 Ga0496124_0002851 Ga0496124_0002851_12480_13319 272
109 3300048928 Ga0496125_0010731 Ga0496125_0010731_1419_2258 272
110 3300048929 Ga0496126_0133911 Ga0496126_0133911_50_886 272
111 3300048929 Ga0496126_0155479 Ga0496126_0155479_322_1161 272
112 3300049586 Ga0501070_0000472 Ga0501070_0000472_20806_21633 272
113 3300049822 Ga0501035_0093313 Ga0501035_0093313_1128_1955 272
114 iso_pu_bacteria 8046352972 8046353645 272
115 3300003578 Ga0006562J51391_1008124 Ga0006562J51391_100812414 273
116 3300003578 Ga0006562J51391_1008125 Ga0006562J51391_100812512 273
117 3300003752 Ga0055539_1000005 Ga0055539_1000005474 273
118 3300003756 Ga0055533_1000001 Ga0055533_10000011543 273
119 3300003759 Ga0055525_1000290 Ga0055525_100029036 273
120 3300003841 Ga0055541_1005977 Ga0055541_10059772 273
121 3300006051 Ga0075364_10227017 Ga0075364_102270172 273
122 3300013105 Ga0157369_10063810 Ga0157369_100638105 273
123 3300013105 Ga0157369_10207577 Ga0157369_102075772 273
124 3300013307 Ga0157372_10527938 Ga0157372_105279382 273
125 3300020081 Ga0206354_10149218 Ga0206354_101492182 273
126 3300020082 Ga0206353_10064343 Ga0206353_100643433 273
127 3300025225 Ga0209566_100053 Ga0209566_100053129 273
128 3300025226 Ga0209674_100001 Ga0209674_1000011544 273
129 3300025230 Ga0209563_100001 Ga0209563_1000011544 273
130 3300025230 Ga0209563_100314 Ga0209563_10031411 273
131 3300025253 Ga0209677_100001 Ga0209677_1000011544 273
132 3300025253 Ga0209677_100767 Ga0209677_10076713 273
133 3300031901 Ga0307406_10092255 Ga0307406_100922552 273
134 3300037312 Ga0395899_0001710 Ga0395899_0001710_7617_8438 273
135 3300037418 Ga0395900_0114607 Ga0395900_0114607_1419_2240 273
136 3300037466 Ga0395898_0129715 Ga0395898_0129715_1548_2369 273
137 3300044658 Ga0466972_0041847 Ga0466972_0041847_1147_1983 273
138 3300044658 Ga0466972_0117253 Ga0466972_0117253_255_1091 273
139 3300044693 Ga0466961_0156727 Ga0466961_0156727_420_1250 273
140 3300044735 Ga0466968_0031131 Ga0466968_0031131_1351_2187 273
141 3300044765 Ga0466970_0106217 Ga0466970_0106217_520_1356 273
142 3300044765 Ga0466970_0109307 Ga0466970_0109307_412_1248 273
143 3300044842 Ga0466957_0088438 Ga0466957_0088438_25_861 273
144 3300045049 Ga0466959_0012663 Ga0466959_0012663_5220_6056 273
145 3300046453 Ga0495627_001242 Ga0495627_001242_7479_8306 273
146 3300048916 Ga0496113_0275127 Ga0496113_0275127_90_911 273
147 3300048920 Ga0496117_0000726 Ga0496117_0000726_683_1507 273
148 3300048920 Ga0496117_0009141 Ga0496117_0009141_5080_5901 273
149 3300048921 Ga0496118_0051220 Ga0496118_0051220_2270_3094 273
150 3300048925 Ga0496122_0019490 Ga0496122_0019490_4604_5428 273
151 3300048927 Ga0496124_0268895 Ga0496124_0268895_118_942 273
152 3300048928 Ga0496125_0001305 Ga0496125_0001305_2106_2930 273
153 3300048929 Ga0496126_0012712 Ga0496126_0012712_3350_4174 273
154 3300049571 Ga0501034_0001844 Ga0501034_0001844_9195_10046 273
155 3300049580 Ga0501046_0031887 Ga0501046_0031887_3397_4236 273
156 3300049822 Ga0501035_0073796 Ga0501035_0073796_409_1248 273
157 3300050491 nmdc:mga00v17_2726_c1 nmdc:mga00v17_2726_c1_5188_6021 273
158 3300003214 JGI25165J46597_1000332 JGI25165J46597_100033213 276
159 3300025231 Ga0207427_100042 Ga0207427_100042210 276
160 3300025261 Ga0209233_1000001 Ga0209233_10000011296 276
161 3300044658 Ga0466972_0039522 Ga0466972_0039522_748_1617 276
162 3300044683 Ga0466965_0082261 Ga0466965_0082261_311_1180 276
163 3300044693 Ga0466961_0068466 Ga0466961_0068466_1372_2241 276
164 3300044901 Ga0466960_0050861 Ga0466960_0050861_387_1247 276
165 3300045836 Ga0466958_0309853 Ga0466958_0309853_24_893 276

Structural Annotation

Top 5 Hits

ID Description Score Start End
5i2h-assembly1.cif.gz_B crystal structure of o-methyltransferase family 2 protein plim_1147 from planctomyces limnophilus dsm 3776 complex with apigenin 0.8097 39 155
1qzz-assembly1.cif.gz_A crystal structure of aclacinomycin-10-hydroxylase (rdmb) in complex with s-adenosyl-l-methionine (sam) 0.8035 36 155
6nej-assembly1.cif.gz_B scoulerine 9-o-methyltransferase from thalictrum flavum complexed (13as)-3,10-dimethoxy-5,8,13,13a-tetrahydro-6h-isoquino[3,2-a]isoquinoline-2,9-diol and with s-adenosyl-l-homocysteine 0.8008 36 155
4qdk-assembly2.cif.gz_A crystal structure of magnesium protoporphyrin ix methyltransferase (chlm) from synechocystis pcc 6803 with bound sah 0.7895 21 157
3g2m-assembly1.cif.gz_A crystal structure of the glycopeptide n-methyltransferase mtfa 0.7832 21 155
ID Description Score Start End Superfamily
af_Q8I4V3_239_421_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8027 111 155 3.40.50.150
af_Q0IP69_124_375_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7977 39 155 3.40.50.150
af_A0A1D6QMW6_179_313_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7973 41 154 3.40.50.150
3d2lA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7961 22 156 3.40.50.150
af_A0A1D6NEM6_1_118_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7856 69 154 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A6J7E4L4-F1-model_v4 Unannotated protein 0.9948 189 271
AF-A0A6F8YHA8-F1-model_v4 Uncharacterized protein 0.9918 137 271
AF-A0A1Y6FG34-F1-model_v4 Methyltransferase domain-containing protein 0.9894 5 271
AF-A0A6N9VX36-F1-model_v4 deleted 0.9888 150 274
AF-A0A2W6WPW6-F1-model_v4 SAM-dependent methyltransferase 0.9876 4 271 GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
94.14 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map