F245380

General Info

Members Datasets Scaffolds Average Seq Length
165 109 165 201

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100880282|Ga0070670_1008802821
Length 207
Sequence MQALKAELPPESPAGSDPVKRLMERLREERFTTDQTDQEWEEFGEIIFHRGEKISFADGETVFIFTRVDDLDEAILKQTSDSVVHTYKAKNPRQKALSVLQSTTIYHCLVVPGDQPHNEMLSDFVKRQLGATFIPVVIVPEINQVIYPDVEEKVGTFRPRIEYLQYLLGERRTTVNMHKTTKQAMWISLAVLVVLILLIAASLIPHS

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
65 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
66 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
91 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
92 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
93 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
94 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
95 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
96 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
97 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
98 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
99 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
100 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
101 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
102 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
103 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
104 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
105 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
106 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
107 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
108 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
109 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.61
Rhizosphere 92.73
Stem 0
Stem Tuber 0
Unclassified 6.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_2328740 2162886012 Bacteria 817
2 Ga0065707_10243937 3300005295 Bacteria 1146
3 Ga0070676_10674879 3300005328 Unclassified 752
4 Ga0070683_100000067 3300005329 Bacteria 73813
5 Ga0070683_100341403 3300005329 Unclassified 1426
6 Ga0070670_100001897 3300005331 Bacteria 17086
7 Ga0070670_100066568 3300005331 Bacteria 3091
8 Ga0070670_100880282 3300005331 Unclassified 811
9 Ga0068869_100001268 3300005334 Bacteria 14937
10 Ga0070680_100212231 3300005336 Unclassified 1633
11 Ga0070682_100000003 3300005337 Bacteria 469319
12 Ga0070682_100138900 3300005337 Bacteria 1654
13 Ga0068868_100001196 3300005338 Bacteria 17821
14 Ga0068868_100001953 3300005338 Bacteria 14148
15 Ga0070689_100031529 3300005340 Bacteria 4029
16 Ga0070689_100726622 3300005340 Bacteria 869
17 Ga0070661_100221909 3300005344 Bacteria 1450
18 Ga0070675_100000020 3300005354 Bacteria 168778
19 Ga0070671_100043786 3300005355 Bacteria 3720
20 Ga0070671_100837180 3300005355 Bacteria 802
21 Ga0070700_100000104 3300005441 Bacteria 53476
22 Ga0070708_100866000 3300005445 Unclassified 849
23 Ga0070678_101108978 3300005456 Bacteria 731
24 Ga0068867_100239881 3300005459 Bacteria 1470
25 Ga0070685_10012375 3300005466 Bacteria 4481
26 Ga0070706_100020825 3300005467 Bacteria 6038
27 Ga0070706_100627421 3300005467 Bacteria 998
28 Ga0070707_100048695 3300005468 Bacteria 4060
29 Ga0070707_100367061 3300005468 Bacteria 1398
30 Ga0070698_100026592 3300005471 Bacteria 6023
31 Ga0070698_100490939 3300005471 Bacteria 1165
32 Ga0070698_100654093 3300005471 Unclassified 992
33 Ga0070699_100034588 3300005518 Bacteria 4367
34 Ga0070699_100103448 3300005518 Unclassified 2497
35 Ga0070699_100274467 3300005518 Unclassified 1509
36 Ga0070684_100001761 3300005535 Bacteria 15796
37 Ga0070684_100354392 3300005535 Bacteria 1350
38 Ga0070697_100028831 3300005536 Bacteria 4447
39 Ga0070697_101043123 3300005536 Bacteria 727
40 Ga0068853_100053981 3300005539 Bacteria 3462
41 Ga0070672_100000242 3300005543 Bacteria 30531
42 Ga0070686_100127229 3300005544 Unclassified 1757
43 Ga0070696_100073704 3300005546 Unclassified 2406
44 Ga0070693_100034042 3300005547 Bacteria 2816
45 Ga0068857_100029700 3300005577 Bacteria 4825
46 Ga0068854_100063943 3300005578 Bacteria 2672
47 Ga0070702_100001866 3300005615 Bacteria 8810
48 Ga0070702_100052152 3300005615 Archaea 2345
49 Ga0070702_100249970 3300005615 Unclassified 1201
50 Ga0068859_100662259 3300005617 Bacteria 1136
51 Ga0068864_100000013 3300005618 Bacteria 326235
52 Ga0068864_100540781 3300005618 Bacteria 1125
53 Ga0068861_100110604 3300005719 Bacteria 2201
54 Ga0068870_10029424 3300005840 Bacteria 2767
55 Ga0068870_10064964 3300005840 Bacteria 1972
56 Ga0068858_100000011 3300005842 Bacteria 233214
57 Ga0070716_100539905 3300006173 Bacteria 867
58 Ga0068871_100411564 3300006358 Unclassified 1206
59 Ga0068871_100423699 3300006358 Bacteria 1189
60 Ga0075428_100091544 3300006844 Bacteria 3317
61 Ga0075428_100512417 3300006844 Bacteria 1283
62 Ga0075431_100012579 3300006847 Bacteria 8541
63 Ga0075433_10535328 3300006852 Bacteria 1030
64 Ga0075434_100210825 3300006871 Bacteria 1963
65 Ga0075429_100063364 3300006880 Bacteria 3221
66 Ga0097620_100662266 3300006931 Bacteria 1136
67 Ga0075435_100000056 3300007076 Bacteria 58362
68 Ga0075435_100119966 3300007076 Unclassified 2194
69 Ga0105240_10005713 3300009093 Bacteria 18456
70 Ga0111539_10000145 3300009094 Bacteria 81751
71 Ga0105245_10000013 3300009098 Bacteria 266248
72 Ga0105245_10002515 3300009098 Bacteria 16530
73 Ga0105245_10003388 3300009098 Bacteria 14275
74 Ga0105245_10117091 3300009098 Bacteria 2485
75 Ga0105245_10391879 3300009098 Bacteria 1386
76 Ga0105242_10015774 3300009176 Bacteria 5869
77 Ga0105248_10211411 3300009177 Bacteria 2186
78 Ga0105238_10000001 3300009551 Bacteria 2036163
79 Ga0105239_10083642 3300010375 Bacteria 3515
80 Ga0105246_10253243 3300011119 Bacteria 1399
81 Ga0157369_10000282 3300013105 Bacteria 68052
82 Ga0157374_10000010 3300013296 Bacteria 505635
83 Ga0157378_10000034 3300013297 Bacteria 120274
84 Ga0157378_10003554 3300013297 Bacteria 13811
85 Ga0157378_10003849 3300013297 Bacteria 13276
86 Ga0157378_10081428 3300013297 Bacteria 2926
87 Ga0163162_10811098 3300013306 Bacteria 1053
88 Ga0157375_10000012 3300013308 Bacteria 330517
89 Ga0157375_10000054 3300013308 Bacteria 126807
90 Ga0157375_10000946 3300013308 Bacteria 25152
91 Ga0163163_10380149 3300014325 Bacteria 1470
92 Ga0157380_10022762 3300014326 Bacteria 4724
93 Ga0157377_10000015 3300014745 Bacteria 190735
94 Ga0157377_10000122 3300014745 Bacteria 50493
95 Ga0157376_10000019 3300014969 Bacteria 255553
96 Ga0213873_10000002 3300021358 Bacteria 1164195
97 Ga0213873_10002560 3300021358 Unclassified 3164
98 Ga0213876_10000001 3300021384 Bacteria 1186326
99 Ga0213876_10000014 3300021384 Bacteria 310412
100 Ga0207699_10267686 3300025906 Bacteria 1183
101 Ga0207645_10168262 3300025907 Bacteria 1435
102 Ga0207684_10094060 3300025910 Unclassified 2556
103 Ga0207695_10024744 3300025913 Bacteria 6742
104 Ga0207695_10871945 3300025913 Unclassified 780
105 Ga0207660_10067241 3300025917 Unclassified 2595
106 Ga0207662_10017662 3300025918 Bacteria 4038
107 Ga0207694_10000001 3300025924 Bacteria 4078485
108 Ga0207650_10001461 3300025925 Bacteria 17006
109 Ga0207650_10013159 3300025925 Bacteria 5727
110 Ga0207650_10572646 3300025925 Unclassified 948
111 Ga0207659_10000035 3300025926 Bacteria 104092
112 Ga0207687_10000014 3300025927 Bacteria 297704
113 Ga0207687_10000301 3300025927 Bacteria 33834
114 Ga0207687_10002093 3300025927 Bacteria 13637
115 Ga0207687_10245815 3300025927 Bacteria 1420
116 Ga0207670_10570384 3300025936 Bacteria 927
117 Ga0207670_10657811 3300025936 Bacteria 864
118 Ga0207691_10000444 3300025940 Bacteria 40991
119 Ga0207689_10026765 3300025942 Bacteria 4830
120 Ga0207661_10000004 3300025944 Bacteria 606391
121 Ga0207661_10269070 3300025944 Unclassified 1520
122 Ga0207661_10676052 3300025944 Bacteria 949
123 Ga0207640_10013420 3300025981 Bacteria 4694
124 Ga0207640_10166181 3300025981 Bacteria 1639
125 Ga0207677_10000002 3300026023 Bacteria 478921
126 Ga0207677_10000122 3300026023 Bacteria 63627
127 Ga0207703_10000004 3300026035 Bacteria 526312
128 Ga0207703_10258956 3300026035 Unclassified 1572
129 Ga0207639_10000006 3300026041 Bacteria 544415
130 Ga0207708_10000012 3300026075 Bacteria 207611
131 Ga0207648_10341059 3300026089 Bacteria 1349
132 Ga0207648_10580383 3300026089 Bacteria 1032
133 Ga0207676_10000030 3300026095 Bacteria 221663
134 Ga0207676_10462832 3300026095 Bacteria 1198
135 Ga0207674_10240020 3300026116 Bacteria 1759
136 Ga0207675_100038322 3300026118 Bacteria 4472
137 Ga0207428_10000209 3300027907 Bacteria 81761
138 Ga0307511_10003097 3300030521 Bacteria 17138
139 Ga0307516_10446994 3300031730 Unclassified 949
140 Ga0436365_0236662 3300039437 Bacteria 205513
141 Ga0436365_0332720 3300039437 Bacteria 227622
142 Ga0436365_0497973 3300039437 Bacteria 1494
143 Ga0436365_0643761 3300039437 Bacteria 10023
144 Ga0436365_1045261 3300039437 Bacteria 943
145 Ga0436363_1260452 3300039450 Bacteria 1635
146 Ga0436362_0660519 3300039453 Bacteria 832172
147 Ga0436362_0958893 3300039453 Bacteria 24381
148 Ga0451837_0080435 3300041494 Bacteria 712
149 Ga0453683_0059432 3300044673 Unclassified 2390
150 Ga0495620_0025845 3300046515 Bacteria 2770
151 Ga0495621_0041259 3300046539 Bacteria 1620
152 Ga0495679_038669 3300047446 Bacteria 1493
153 Ga0496106_0179360 3300048909 Bacteria 1681
154 Ga0501073_0029756 3300049589 Bacteria 3903
155 Ga0501080_0002179 3300049742 Bacteria 17010
156 nmdc:mga05p37_157786_c1 3300050507 Unclassified 2772
157 nmdc:mga06r32_115020_c1 3300050510 Bacteria 2649
158 nmdc:mga08y16_80_c1 3300050511 Bacteria 81759
159 nmdc:mga0n895_1323088_c1 3300050512 Bacteria 691
160 nmdc:mga0n895_292297_c1 3300050512 Bacteria 1652
161 nmdc:mga0rr50_350196_c1 3300050513 Unclassified 1242
162 nmdc:mga0rr50_40_c1 3300050513 Bacteria 83054
163 nmdc:mga0rr50_4336_c1 3300050513 Bacteria 8320
164 nmdc:mga0a205_405367_c1 3300050515 Unclassified 1227
165 Ga0495655_0091741 3300053083 Bacteria 886

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025918 Ga0207662_10017662 Ga0207662_100176622 166
2 3300005840 Ga0068870_10029424 Ga0068870_100294246 175
3 3300005340 Ga0070689_100031529 Ga0070689_1000315294 177
4 3300005544 Ga0070686_100127229 Ga0070686_1001272292 177
5 3300005547 Ga0070693_100034042 Ga0070693_1000340422 177
6 3300005578 Ga0068854_100063943 Ga0068854_1000639434 177
7 3300005615 Ga0070702_100001866 Ga0070702_1000018666 177
8 3300005842 Ga0068858_100000011 Ga0068858_10000001159 177
9 3300009098 Ga0105245_10002515 Ga0105245_1000251510 177
10 3300009098 Ga0105245_10117091 Ga0105245_101170912 177
11 3300010375 Ga0105239_10083642 Ga0105239_100836422 177
12 3300013297 Ga0157378_10003849 Ga0157378_1000384912 177
13 3300025981 Ga0207640_10166181 Ga0207640_101661812 177
14 3300026035 Ga0207703_10000004 Ga0207703_10000004345 177
15 3300039437 Ga0436365_0643761 Ga0436365_0643761_6865_7416 177
16 3300039450 Ga0436363_1260452 Ga0436363_1260452_41_595 177
17 3300050512 nmdc:mga0n895_1323088_c1 nmdc:mga0n895_1323088_c1_48_605 177
18 3300025907 Ga0207645_10168262 Ga0207645_101682622 180
19 3300014745 Ga0157377_10000122 Ga0157377_1000012221 181
20 3300009098 Ga0105245_10003388 Ga0105245_100033887 189
21 3300013306 Ga0163162_10811098 Ga0163162_108110982 189
22 3300025927 Ga0207687_10002093 Ga0207687_100020939 189
23 3300050513 nmdc:mga0rr50_4336_c1 nmdc:mga0rr50_4336_c1_4419_5009 190
24 3300005337 Ga0070682_100000003 Ga0070682_100000003136 191
25 3300005617 Ga0068859_100662259 Ga0068859_1006622591 194
26 3300006931 Ga0097620_100662266 Ga0097620_1006622661 194
27 3300014969 Ga0157376_10000019 Ga0157376_10000019138 194
28 3300025936 Ga0207670_10570384 Ga0207670_105703841 194
29 3300005441 Ga0070700_100000104 Ga0070700_1000001044 195
30 3300005543 Ga0070672_100000242 Ga0070672_10000024224 195
31 3300005577 Ga0068857_100029700 Ga0068857_1000297007 195
32 3300009177 Ga0105248_10211411 Ga0105248_102114112 195
33 3300011119 Ga0105246_10253243 Ga0105246_102532432 195
34 3300013297 Ga0157378_10000034 Ga0157378_1000003487 195
35 3300013297 Ga0157378_10003554 Ga0157378_100035547 195
36 3300013308 Ga0157375_10000012 Ga0157375_10000012260 195
37 3300026075 Ga0207708_10000012 Ga0207708_10000012150 195
38 3300026116 Ga0207674_10240020 Ga0207674_102400202 195
39 3300046515 Ga0495620_0025845 Ga0495620_0025845_1223_1840 195
40 3300047446 Ga0495679_038669 Ga0495679_038669_488_1117 195
41 3300048909 Ga0496106_0179360 Ga0496106_0179360_72_701 195
42 3300005546 Ga0070696_100073704 Ga0070696_1000737045 196
43 3300005618 Ga0068864_100000013 Ga0068864_10000001340 196
44 3300006358 Ga0068871_100423699 Ga0068871_1004236991 196
45 3300013308 Ga0157375_10000054 Ga0157375_1000005427 196
46 3300014326 Ga0157380_10022762 Ga0157380_100227623 196
47 3300025940 Ga0207691_10000444 Ga0207691_1000044433 196
48 3300005344 Ga0070661_100221909 Ga0070661_1002219091 197
49 3300005355 Ga0070671_100837180 Ga0070671_1008371801 197
50 3300006173 Ga0070716_100539905 Ga0070716_1005399052 197
51 3300006871 Ga0075434_100210825 Ga0075434_1002108251 197
52 3300013297 Ga0157378_10081428 Ga0157378_100814282 197
53 3300025927 Ga0207687_10000301 Ga0207687_1000030132 197
54 3300026095 Ga0207676_10000030 Ga0207676_10000030124 197
55 3300050513 nmdc:mga0rr50_350196_c1 nmdc:mga0rr50_350196_c1_397_1008 197
56 3300005468 Ga0070707_100367061 Ga0070707_1003670612 198
57 3300007076 Ga0075435_100000056 Ga0075435_10000005644 198
58 3300026089 Ga0207648_10580383 Ga0207648_105803832 198
59 3300039437 Ga0436365_0497973 Ga0436365_0497973_124_738 198
60 3300050513 nmdc:mga0rr50_40_c1 nmdc:mga0rr50_40_c1_74575_75189 198
61 2162886012 MBSR1b_contig_2328740 MBSR1b_0050.00006740 199
62 3300005295 Ga0065707_10243937 Ga0065707_102439372 199
63 3300005328 Ga0070676_10674879 Ga0070676_106748792 199
64 3300005329 Ga0070683_100000067 Ga0070683_10000006712 199
65 3300005329 Ga0070683_100341403 Ga0070683_1003414032 199
66 3300005331 Ga0070670_100001897 Ga0070670_1000018974 199
67 3300005331 Ga0070670_100066568 Ga0070670_1000665684 199
68 3300005331 Ga0070670_100880282 Ga0070670_1008802821 199
69 3300005334 Ga0068869_100001268 Ga0068869_10000126815 199
70 3300005336 Ga0070680_100212231 Ga0070680_1002122311 199
71 3300005337 Ga0070682_100138900 Ga0070682_1001389002 199
72 3300005338 Ga0068868_100001196 Ga0068868_1000011965 199
73 3300005338 Ga0068868_100001953 Ga0068868_10000195314 199
74 3300005340 Ga0070689_100726622 Ga0070689_1007266222 199
75 3300005354 Ga0070675_100000020 Ga0070675_10000002059 199
76 3300005355 Ga0070671_100043786 Ga0070671_1000437864 199
77 3300005445 Ga0070708_100866000 Ga0070708_1008660001 199
78 3300005456 Ga0070678_101108978 Ga0070678_1011089781 199
79 3300005459 Ga0068867_100239881 Ga0068867_1002398812 199
80 3300005466 Ga0070685_10012375 Ga0070685_100123752 199
81 3300005467 Ga0070706_100020825 Ga0070706_1000208252 199
82 3300005467 Ga0070706_100627421 Ga0070706_1006274212 199
83 3300005468 Ga0070707_100048695 Ga0070707_1000486956 199
84 3300005471 Ga0070698_100026592 Ga0070698_1000265924 199
85 3300005471 Ga0070698_100490939 Ga0070698_1004909393 199
86 3300005471 Ga0070698_100654093 Ga0070698_1006540931 199
87 3300005518 Ga0070699_100034588 Ga0070699_1000345883 199
88 3300005518 Ga0070699_100103448 Ga0070699_1001034483 199
89 3300005518 Ga0070699_100274467 Ga0070699_1002744671 199
90 3300005535 Ga0070684_100001761 Ga0070684_10000176112 199
91 3300005535 Ga0070684_100354392 Ga0070684_1003543921 199
92 3300005536 Ga0070697_100028831 Ga0070697_1000288313 199
93 3300005536 Ga0070697_101043123 Ga0070697_1010431231 199
94 3300005539 Ga0068853_100053981 Ga0068853_1000539813 199
95 3300005615 Ga0070702_100052152 Ga0070702_1000521524 199
96 3300005615 Ga0070702_100249970 Ga0070702_1002499702 199
97 3300005618 Ga0068864_100540781 Ga0068864_1005407812 199
98 3300005719 Ga0068861_100110604 Ga0068861_1001106042 199
99 3300005840 Ga0068870_10064964 Ga0068870_100649643 199
100 3300006358 Ga0068871_100411564 Ga0068871_1004115642 199
101 3300006844 Ga0075428_100091544 Ga0075428_1000915444 199
102 3300006844 Ga0075428_100512417 Ga0075428_1005124172 199
103 3300006847 Ga0075431_100012579 Ga0075431_1000125795 199
104 3300006852 Ga0075433_10535328 Ga0075433_105353282 199
105 3300006880 Ga0075429_100063364 Ga0075429_1000633643 199
106 3300007076 Ga0075435_100119966 Ga0075435_1001199664 199
107 3300009093 Ga0105240_10005713 Ga0105240_100057135 199
108 3300009094 Ga0111539_10000145 Ga0111539_1000014571 199
109 3300009098 Ga0105245_10000013 Ga0105245_10000013108 199
110 3300009098 Ga0105245_10391879 Ga0105245_103918792 199
111 3300009176 Ga0105242_10015774 Ga0105242_100157746 199
112 3300009551 Ga0105238_10000001 Ga0105238_1000000172 199
113 3300013105 Ga0157369_10000282 Ga0157369_1000028220 199
114 3300013296 Ga0157374_10000010 Ga0157374_1000001065 199
115 3300013308 Ga0157375_10000946 Ga0157375_100009468 199
116 3300014325 Ga0163163_10380149 Ga0163163_103801492 199
117 3300014745 Ga0157377_10000015 Ga0157377_1000001572 199
118 3300021358 Ga0213873_10000002 Ga0213873_10000002267 199
119 3300021358 Ga0213873_10002560 Ga0213873_100025602 199
120 3300021384 Ga0213876_10000001 Ga0213876_10000001350 199
121 3300021384 Ga0213876_10000014 Ga0213876_10000014126 199
122 3300025906 Ga0207699_10267686 Ga0207699_102676862 199
123 3300025910 Ga0207684_10094060 Ga0207684_100940602 199
124 3300025913 Ga0207695_10024744 Ga0207695_100247444 199
125 3300025913 Ga0207695_10871945 Ga0207695_108719452 199
126 3300025917 Ga0207660_10067241 Ga0207660_100672414 199
127 3300025924 Ga0207694_10000001 Ga0207694_100000011117 199
128 3300025925 Ga0207650_10001461 Ga0207650_1000146114 199
129 3300025925 Ga0207650_10013159 Ga0207650_100131594 199
130 3300025925 Ga0207650_10572646 Ga0207650_105726461 199
131 3300025926 Ga0207659_10000035 Ga0207659_1000003543 199
132 3300025927 Ga0207687_10000014 Ga0207687_10000014109 199
133 3300025927 Ga0207687_10245815 Ga0207687_102458153 199
134 3300025936 Ga0207670_10657811 Ga0207670_106578111 199
135 3300025942 Ga0207689_10026765 Ga0207689_100267654 199
136 3300025944 Ga0207661_10000004 Ga0207661_10000004156 199
137 3300025944 Ga0207661_10269070 Ga0207661_102690703 199
138 3300025944 Ga0207661_10676052 Ga0207661_106760521 199
139 3300025981 Ga0207640_10013420 Ga0207640_100134203 199
140 3300026023 Ga0207677_10000002 Ga0207677_10000002261 199
141 3300026023 Ga0207677_10000122 Ga0207677_100001222 199
142 3300026035 Ga0207703_10258956 Ga0207703_102589561 199
143 3300026041 Ga0207639_10000006 Ga0207639_10000006252 199
144 3300026089 Ga0207648_10341059 Ga0207648_103410592 199
145 3300026095 Ga0207676_10462832 Ga0207676_104628322 199
146 3300026118 Ga0207675_100038322 Ga0207675_1000383223 199
147 3300027907 Ga0207428_10000209 Ga0207428_1000020973 199
148 3300030521 Ga0307511_10003097 Ga0307511_1000309712 199
149 3300031730 Ga0307516_10446994 Ga0307516_104469941 199
150 3300039437 Ga0436365_0236662 Ga0436365_0236662_184584_185201 199
151 3300039437 Ga0436365_0332720 Ga0436365_0332720_129284_129901 199
152 3300039437 Ga0436365_1045261 Ga0436365_1045261_291_908 199
153 3300039453 Ga0436362_0660519 Ga0436362_0660519_672105_672722 199
154 3300039453 Ga0436362_0958893 Ga0436362_0958893_11960_12577 199
155 3300041494 Ga0451837_0080435 Ga0451837_0080435_40_657 199
156 3300044673 Ga0453683_0059432 Ga0453683_0059432_1607_2227 199
157 3300046539 Ga0495621_0041259 Ga0495621_0041259_309_926 199
158 3300049589 Ga0501073_0029756 Ga0501073_0029756_3039_3656 199
159 3300049742 Ga0501080_0002179 Ga0501080_0002179_12839_13456 199
160 3300050507 nmdc:mga05p37_157786_c1 nmdc:mga05p37_157786_c1_1153_1773 199
161 3300050510 nmdc:mga06r32_115020_c1 nmdc:mga06r32_115020_c1_464_1081 199
162 3300050511 nmdc:mga08y16_80_c1 nmdc:mga08y16_80_c1_7312_7929 199
163 3300050512 nmdc:mga0n895_292297_c1 nmdc:mga0n895_292297_c1_230_847 199
164 3300050515 nmdc:mga0a205_405367_c1 nmdc:mga0a205_405367_c1_382_1005 199
165 3300053083 Ga0495655_0091741 Ga0495655_0091741_100_717 199

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qrd-assembly3.cif.gz_B crystal structure of the adenylate sensor from amp-activated protein kinase in complex with adp and atp 0.6382 31 66
2qr1-assembly1.cif.gz_B crystal structure of the adenylate sensor from amp-activated protein kinase in complex with adp 0.6365 31 66
3mpr-assembly2.cif.gz_D crystal structure of endonuclease/exonuclease/phosphatase family protein from bacteroides thetaiotaomicron, northeast structural genomics consortium target btr318a 0.5387 45 86
1rqq-assembly1.cif.gz_D crystal structure of the insulin receptor kinase in complex with the sh2 domain of aps 0.5236 136 171
5w3y-assembly4.cif.gz_D crystal structure of popp2 c321a in complex with ip6 and accoa 0.5232 46 118
ID Description Score Start End Superfamily
4qfrB02 Special;Other non-globular;Double Stranded RNA Binding Domain; 0.6921 31 66 6.20.250.60
af_Q682V0_22_133_2.170.210.10 Mainly Beta;Beta Complex;Dna Repair Protein Xrcc4; Chain: A, domain 1;DNA double-strand break repair and VJ recombination XRCC4, N-terminal 0.6571 31 66 2.170.210.10
af_D4A3B6_1_93_2.40.15.10 Mainly Beta;Beta Barrel;Proto-oncogene - Oncogene Product P14tcl1;TCL1/MTCP1 0.6535 42 63 2.40.15.10
2qrdB01 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.6382 31 66 2.20.25.290
1syoB02 Mainly Beta;Distorted Sandwich;Cation-dependent Mannose-6-phosphate Receptor; Chain A;Mannose-6-phosphate receptor binding domain 0.5996 45 73 2.70.130.10
ID Description Score Start End GO Terms
AF-A0A2V7WMA3-F1-model_v4 Uncharacterized protein 0.8505 1 199 GO:0016020
AF-A0A2V7WMA3-F1-model_v4 Uncharacterized protein 0.8464 1 199 GO:0016020
AF-A0A1F8MA87-F1-model_v4 Uncharacterized protein 0.6937 18 168
AF-A0A7X7VDV2-F1-model_v4 DZANK-type domain-containing protein 0.6921 18 168
AF-A0A348ZYV7-F1-model_v4 DZANK-type domain-containing protein 0.6884 18 172

Feature Viewer

pLDDT pTM Quality
83.35 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map