F244875

General Info

Members Datasets Scaffolds Average Seq Length
164 114 155 154

Family's Representative Sequence

Representative Sequence 3300050496|nmdc:mga07m45_6_c1|nmdc:mga07m45_6_c1_8098_8622
Length 174
Sequence LSGDLNVEDINGEPATCGLAILWHSRTGAAQAMARAAADGAGEGALLVRADEAEPELFLLARGYLFVCPENLASMSGAMKEMFDRCYYPLLSRIEGRPYATAIAAGSDGTQAQAQIDRIVTGWRLRRVAEPLIVNLGAQSPEAILAPKNLSSAATQQCRDLGMMMAEGLRLGIY

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
3 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
4 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
5 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
6 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
7 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
8 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
9 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
37 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
41 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
55 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
59 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
60 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
61 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
62 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
63 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
64 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
65 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
66 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
67 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
68 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
69 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
70 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
71 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
72 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
73 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
74 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
75 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
76 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
77 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
78 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
79 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
80 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
81 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
82 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
83 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
84 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
85 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
86 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
89 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
90 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
91 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
92 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
93 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
94 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
95 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
96 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
97 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
98 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
99 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
100 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
101 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
102 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
103 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
104 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
105 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
106 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
107 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
108 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
109 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.46
Metatranscriptomes 3.05
Isolates 5.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25
Nodule 0
Rhizoplane 2.44
Rhizosphere 65.24
Stem 0
Stem Tuber 0
Unclassified 7.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2447314 2162886007 Bacteria 6982
2 Ga0065704_10070447 3300005289 Bacteria 24411
3 Ga0070670_100020848 3300005331 Bacteria 5636
4 Ga0070670_100222394 3300005331 Bacteria 1643
5 Ga0070668_100002953 3300005347 Bacteria 12570
6 Ga0070671_100003290 3300005355 Bacteria 12610
7 Ga0070671_100159917 3300005355 Bacteria 1904
8 Ga0070671_101753624 3300005355 Bacteria 551
9 Ga0070667_100001006 3300005367 Bacteria 25830
10 Ga0070667_100043406 3300005367 Bacteria 3773
11 Ga0070706_100484891 3300005467 Bacteria 1150
12 Ga0070665_100033583 3300005548 Bacteria 5163
13 Ga0068857_100160894 3300005577 Bacteria 2037
14 Ga0068854_100007618 3300005578 Bacteria 6924
15 Ga0068852_100119349 3300005616 Bacteria 2411
16 Ga0068852_100650184 3300005616 Bacteria 1062
17 Ga0068859_100004701 3300005617 Bacteria 13892
18 Ga0068864_100147881 3300005618 Bacteria 2125
19 Ga0068861_100043364 3300005719 Bacteria 3376
20 Ga0068863_100000676 3300005841 Bacteria 34484
21 Ga0068863_100005564 3300005841 Bacteria 12385
22 Ga0068858_100027140 3300005842 Bacteria 5319
23 Ga0068858_100197778 3300005842 Bacteria 1900
24 Ga0068860_100000007 3300005843 Bacteria 429329
25 Ga0068860_100020466 3300005843 Bacteria 6408
26 Ga0068860_100177465 3300005843 Bacteria 2059
27 Ga0068860_101265281 3300005843 Bacteria 758
28 Ga0068862_100008557 3300005844 Bacteria 8467
29 Ga0068862_100114867 3300005844 Bacteria 2367
30 Ga0075368_10001343 3300006042 Bacteria 7820
31 Ga0075364_10001650 3300006051 Bacteria 12260
32 Ga0075364_10002886 3300006051 Bacteria 9690
33 Ga0075362_10001327 3300006177 Bacteria 7824
34 Ga0075367_10001461 3300006178 Bacteria 10189
35 Ga0075370_10000003 3300006353 Bacteria 133163
36 Ga0075370_10012373 3300006353 Bacteria 4508
37 Ga0075370_10076736 3300006353 Bacteria 1917
38 Ga0075370_10522263 3300006353 Bacteria 717
39 Ga0075430_100146830 3300006846 Unclassified 1964
40 Ga0097620_100004701 3300006931 Bacteria 13892
41 Ga0105240_10070565 3300009093 Bacteria 4321
42 Ga0105240_11634316 3300009093 Bacteria 674
43 Ga0105240_12574891 3300009093 Bacteria 526
44 Ga0105248_10002083 3300009177 Bacteria 22124
45 Ga0105248_10006520 3300009177 Bacteria 12796
46 Ga0157371_10493411 3300013102 Bacteria 904
47 Ga0157378_10013786 3300013297 Bacteria 7071
48 Ga0163162_10006444 3300013306 Bacteria 11369
49 Ga0163163_10001956 3300014325 Bacteria 17425
50 Ga0157379_10000505 3300014968 Bacteria 31681
51 Ga0207681_10006974 3300025923 Bacteria 6933
52 Ga0207650_10012993 3300025925 Bacteria 5759
53 Ga0207650_10178418 3300025925 Bacteria 1692
54 Ga0207644_10005782 3300025931 Bacteria 8049
55 Ga0207644_10461375 3300025931 Bacteria 1044
56 Ga0207644_11238608 3300025931 Bacteria 627
57 Ga0207711_10002892 3300025941 Bacteria 15046
58 Ga0207711_10013491 3300025941 Bacteria 6785
59 Ga0207668_10007833 3300025972 Bacteria 6355
60 Ga0207640_10001190 3300025981 Bacteria 14221
61 Ga0207658_10001511 3300025986 Bacteria 18082
62 Ga0207658_10007797 3300025986 Bacteria 7291
63 Ga0207658_10095117 3300025986 Bacteria 2320
64 Ga0207703_10076675 3300026035 Bacteria 2774
65 Ga0207641_10050390 3300026088 Bacteria 3522
66 Ga0207676_10121652 3300026095 Bacteria 2202
67 Ga0207674_10167737 3300026116 Bacteria 2149
68 Ga0207675_100115266 3300026118 Bacteria 2539
69 Ga0207698_10257154 3300026142 Bacteria 1602
70 Ga0207698_10948833 3300026142 Bacteria 869
71 Ga0209813_10000132 3300027866 Bacteria 26788
72 Ga0268266_10035387 3300028379 Bacteria 4248
73 Ga0268266_10084111 3300028379 Bacteria 2778
74 Ga0268266_11860460 3300028379 Bacteria 576
75 Ga0268265_10098943 3300028380 Bacteria 2350
76 Ga0268264_10000077 3300028381 Bacteria 252597
77 Ga0268264_10039388 3300028381 Bacteria 3905
78 Ga0268264_10154304 3300028381 Bacteria 2062
79 Ga0265327_10017804 3300031251 Bacteria 4434
80 Ga0307408_100406048 3300031548 Bacteria 1171
81 Ga0307405_10000277 3300031731 Bacteria 18938
82 Ga0307405_10968591 3300031731 Bacteria 724
83 Ga0307413_10155764 3300031824 Bacteria 1598
84 Ga0307410_10592402 3300031852 Bacteria 924
85 Ga0307406_10161310 3300031901 Bacteria 1612
86 Ga0307407_10006391 3300031903 Bacteria 5229
87 Ga0307412_10059753 3300031911 Bacteria 2556
88 Ga0307412_10801898 3300031911 Bacteria 817
89 Ga0307409_100035134 3300031995 Bacteria 3669
90 Ga0307411_10977235 3300032005 Bacteria 757
91 Ga0307415_100016759 3300032126 Bacteria 4377
92 Ga0307415_101357866 3300032126 Unclassified 675
93 Ga0373962_0049603 3300035242 Bacteria 1207
94 Ga0373931_0976068 3300035691 Bacteria 572
95 Ga0451576_0000007 3300045051 Bacteria 782228
96 Ga0495607_0481588 3300046501 Bacteria 553
97 Ga0495648_0257432 3300046524 Bacteria 839
98 Ga0495654_0036597 3300046530 Bacteria 2466
99 Ga0495668_0129801 3300046616 Bacteria 1380
100 Ga0495668_0285580 3300046616 Bacteria 904
101 Ga0495625_0030329 3300046660 Bacteria 4037
102 Ga0495670_0200451 3300046691 Bacteria 1057
103 Ga0496101_0141588 3300048904 Bacteria 1833
104 Ga0496103_0256149 3300048906 Bacteria 1126
105 Ga0496104_0019858 3300048907 Bacteria 6154
106 Ga0496105_0021244 3300048908 Bacteria 5253
107 Ga0496118_0084126 3300048921 Bacteria 2221
108 Ga0496118_0138051 3300048921 Bacteria 1552
109 Ga0496119_0199100 3300048922 Bacteria 1038
110 Ga0496120_0290841 3300048923 Bacteria 752
111 Ga0496121_0000509 3300048924 Bacteria 74211
112 Ga0496121_0356073 3300048924 Bacteria 973
113 Ga0501034_0444109 3300049571 Bacteria 1216
114 Ga0501042_0105101 3300049578 Bacteria 2032
115 Ga0501044_0002311 3300049823 Bacteria 21722
116 Ga0501044_0560590 3300049823 Bacteria 1039
117 Ga0501044_0602291 3300049823 Bacteria 992
118 Ga0501044_0806559 3300049823 Bacteria 818
119 nmdc:mga03683_192_c1 3300050489 Bacteria 20102
120 nmdc:mga03683_61_c1 3300050489 Bacteria 41527
121 nmdc:mga03n38_9620_c1 3300050490 Bacteria 3524
122 nmdc:mga00v17_2648_c1 3300050491 Bacteria 6665
123 nmdc:mga00v17_27175_c1 3300050491 Bacteria 3339
124 nmdc:mga00v17_434_c1 3300050491 Bacteria 23482
125 nmdc:mga0yw44_42522_c1 3300050492 Bacteria 2710
126 nmdc:mga0k408_10661_c1 3300050493 Bacteria 4977
127 nmdc:mga0k408_733882_c1 3300050493 Bacteria 577
128 nmdc:mga0k408_852772_c1 3300050493 Bacteria 530
129 nmdc:mga06z11_467_c1 3300050494 Bacteria 15048
130 nmdc:mga04h51_343_c1 3300050495 Bacteria 11595
131 nmdc:mga07m45_34700_c1 3300050496 Bacteria 2804
132 nmdc:mga07m45_38_c1 3300050496 Bacteria 65235
133 nmdc:mga07m45_49973_c1 3300050496 Bacteria 1070
134 nmdc:mga07m45_6_c1 3300050496 Bacteria 260521
135 nmdc:mga0qj67_191868_c1 3300050509 Unclassified 1660
136 nmdc:mga0sz30_2862_c1 3300050516 Bacteria 6168
137 nmdc:mga0sz30_4838_c1 3300050516 Bacteria 4171
138 Ga0500641_0015509 3300053096 Bacteria 2831
139 Ga0500555_051757 3300053103 Bacteria 1122
140 Ga0500607_000324 3300053121 Bacteria 45136
141 Ga0500607_001004 3300053121 Bacteria 26809
142 Ga0500608_337231 3300053122 Bacteria 541
143 Ga0500559_0002165 3300053136 Bacteria 10411
144 Ga0500559_0003138 3300053136 Bacteria 8212
145 Ga0500559_0269089 3300053136 Bacteria 802
146 Ga0500564_001449 3300053138 Bacteria 8196
147 Ga0500590_122133 3300053148 Bacteria 1219
148 Ga0500636_0238064 3300053177 Bacteria 937
149 Ga0500567_039328 3300053723 Bacteria 2211
150 Ga0500645_001536 3300053730 Bacteria 11527
151 Ga0587084_000985 3300059477 Bacteria 2539
152 Ga0587070_003853 3300059491 Bacteria 1846
153 Ga0587082_005583 3300059504 Bacteria 1641
154 Ga0587090_001637 3300059510 Bacteria 2311
155 Ga0587111_0005108 3300060346 Bacteria 2001

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046524 Ga0495648_0257432 Ga0495648_0257432_293_712 139
2 3300031731 Ga0307405_10968591 Ga0307405_109685912 140
3 3300031903 Ga0307407_10006391 Ga0307407_100063916 140
4 3300031911 Ga0307412_10059753 Ga0307412_100597532 140
5 3300031995 Ga0307409_100035134 Ga0307409_1000351344 140
6 3300032126 Ga0307415_100016759 Ga0307415_1000167594 140
7 3300035691 Ga0373931_0976068 Ga0373931_0976068_30_521 140
8 3300048921 Ga0496118_0138051 Ga0496118_0138051_32_538 141
9 3300005843 Ga0068860_100177465 Ga0068860_1001774652 142
10 3300006042 Ga0075368_10001343 Ga0075368_100013433 142
11 3300006177 Ga0075362_10001327 Ga0075362_100013274 142
12 3300006178 Ga0075367_10001461 Ga0075367_100014618 142
13 3300006353 Ga0075370_10012373 Ga0075370_100123734 142
14 3300006846 Ga0075430_100146830 Ga0075430_1001468303 142
15 3300009093 Ga0105240_10070565 Ga0105240_100705653 142
16 3300009093 Ga0105240_12574891 Ga0105240_125748911 142
17 3300026142 Ga0207698_10948833 Ga0207698_109488331 142
18 3300027866 Ga0209813_10000132 Ga0209813_1000013222 142
19 3300028381 Ga0268264_10154304 Ga0268264_101543042 142
20 3300031251 Ga0265327_10017804 Ga0265327_100178042 142
21 3300035242 Ga0373962_0049603 Ga0373962_0049603_714_1142 142
22 3300046501 Ga0495607_0481588 Ga0495607_0481588_31_459 142
23 3300048923 Ga0496120_0290841 Ga0496120_0290841_299_727 142
24 3300050489 nmdc:mga03683_192_c1 nmdc:mga03683_192_c1_8054_8482 142
25 3300050489 nmdc:mga03683_61_c1 nmdc:mga03683_61_c1_27209_27637 142
26 3300050490 nmdc:mga03n38_9620_c1 nmdc:mga03n38_9620_c1_1973_2401 142
27 3300050491 nmdc:mga00v17_2648_c1 nmdc:mga00v17_2648_c1_3281_3709 142
28 3300050492 nmdc:mga0yw44_42522_c1 nmdc:mga0yw44_42522_c1_2270_2698 142
29 3300050493 nmdc:mga0k408_10661_c1 nmdc:mga0k408_10661_c1_3305_3733 142
30 3300050493 nmdc:mga0k408_733882_c1 nmdc:mga0k408_733882_c1_130_558 142
31 3300050493 nmdc:mga0k408_852772_c1 nmdc:mga0k408_852772_c1_77_505 142
32 3300050494 nmdc:mga06z11_467_c1 nmdc:mga06z11_467_c1_2100_2528 142
33 3300050495 nmdc:mga04h51_343_c1 nmdc:mga04h51_343_c1_7255_7683 142
34 3300050496 nmdc:mga07m45_38_c1 nmdc:mga07m45_38_c1_54373_54801 142
35 3300050496 nmdc:mga07m45_49973_c1 nmdc:mga07m45_49973_c1_548_976 142
36 3300050509 nmdc:mga0qj67_191868_c1 nmdc:mga0qj67_191868_c1_931_1368 142
37 3300050516 nmdc:mga0sz30_2862_c1 nmdc:mga0sz30_2862_c1_1972_2400 142
38 3300050516 nmdc:mga0sz30_4838_c1 nmdc:mga0sz30_4838_c1_2973_3401 142
39 3300053103 Ga0500555_051757 Ga0500555_051757_10_438 142
40 3300053121 Ga0500607_000324 Ga0500607_000324_7817_8245 142
41 3300053136 Ga0500559_0003138 Ga0500559_0003138_1910_2341 142
42 3300005367 Ga0070667_100043406 Ga0070667_1000434063 143
43 3300025986 Ga0207658_10007797 Ga0207658_100077977 143
44 3300013297 Ga0157378_10013786 Ga0157378_100137865 146
45 3300025925 Ga0207650_10012993 Ga0207650_100129934 146
46 3300053138 Ga0500564_001449 Ga0500564_001449_40_537 146
47 3300053177 Ga0500636_0238064 Ga0500636_0238064_323_820 146
48 3300053723 Ga0500567_039328 Ga0500567_039328_1595_2092 146
49 3300005548 Ga0070665_100033583 Ga0070665_1000335834 147
50 3300005842 Ga0068858_100197778 Ga0068858_1001977782 147
51 3300005843 Ga0068860_100000007 Ga0068860_100000007147 147
52 3300009177 Ga0105248_10002083 Ga0105248_1000208312 147
53 3300025941 Ga0207711_10002892 Ga0207711_1000289213 147
54 3300025986 Ga0207658_10095117 Ga0207658_100951172 147
55 3300026035 Ga0207703_10076675 Ga0207703_100766754 147
56 3300028379 Ga0268266_10035387 Ga0268266_100353873 147
57 3300028381 Ga0268264_10000077 Ga0268264_1000007792 147
58 3300048921 Ga0496118_0084126 Ga0496118_0084126_588_1079 147
59 3300048924 Ga0496121_0000509 Ga0496121_0000509_47120_47611 147
60 3300049823 Ga0501044_0002311 Ga0501044_0002311_10960_11433 147
61 3300053136 Ga0500559_0269089 Ga0500559_0269089_164_637 147
62 3300006051 Ga0075364_10001650 Ga0075364_100016505 150
63 3300050491 nmdc:mga00v17_434_c1 nmdc:mga00v17_434_c1_4319_4825 150
64 3300005331 Ga0070670_100020848 Ga0070670_1000208484 151
65 3300005347 Ga0070668_100002953 Ga0070668_10000295311 151
66 3300005355 Ga0070671_100003290 Ga0070671_1000032906 151
67 3300005617 Ga0068859_100004701 Ga0068859_1000047019 151
68 3300005841 Ga0068863_100000676 Ga0068863_1000006763 151
69 3300005842 Ga0068858_100027140 Ga0068858_1000271406 151
70 3300006931 Ga0097620_100004701 Ga0097620_1000047019 151
71 3300009177 Ga0105248_10006520 Ga0105248_1000652013 151
72 3300013306 Ga0163162_10006444 Ga0163162_1000644415 151
73 3300014325 Ga0163163_10001956 Ga0163163_100019566 151
74 3300014968 Ga0157379_10000505 Ga0157379_100005059 151
75 3300025923 Ga0207681_10006974 Ga0207681_100069746 151
76 3300025931 Ga0207644_10005782 Ga0207644_100057826 151
77 3300025941 Ga0207711_10013491 Ga0207711_100134917 151
78 3300025972 Ga0207668_10007833 Ga0207668_100078335 151
79 3300048904 Ga0496101_0141588 Ga0496101_0141588_132_623 151
80 3300005618 Ga0068864_100147881 Ga0068864_1001478813 152
81 3300005844 Ga0068862_100008557 Ga0068862_1000085572 152
82 3300026095 Ga0207676_10121652 Ga0207676_101216522 152
83 3300028380 Ga0268265_10098943 Ga0268265_100989431 152
84 iso_pu_bacteria 2738541275 2738709305 153
85 iso_pu_bacteria 2738541301 2738847730 153
86 iso_pu_bacteria 2738541304 2738863459 153
87 iso_pu_bacteria 2738543022 2739295977 153
88 iso_pu_bacteria 2738543033 2739357655 153
89 iso_pu_bacteria 2928100450 2928102905 153
90 iso_pu_bacteria 2928959182 2928959471 153
91 iso_pu_bacteria 8054302542 8054305730 153
92 2162886007 SwRhRL2b_contig_2447314 SwRhRL2b_0814.00004480 157
93 3300005289 Ga0065704_10070447 Ga0065704_1007044719 157
94 3300005331 Ga0070670_100222394 Ga0070670_1002223942 157
95 3300005355 Ga0070671_100159917 Ga0070671_1001599172 157
96 3300005355 Ga0070671_101753624 Ga0070671_1017536241 157
97 3300005367 Ga0070667_100001006 Ga0070667_1000010063 157
98 3300005467 Ga0070706_100484891 Ga0070706_1004848912 157
99 3300005577 Ga0068857_100160894 Ga0068857_1001608941 157
100 3300005578 Ga0068854_100007618 Ga0068854_1000076182 157
101 3300005616 Ga0068852_100119349 Ga0068852_1001193492 157
102 3300005616 Ga0068852_100650184 Ga0068852_1006501842 157
103 3300005719 Ga0068861_100043364 Ga0068861_1000433645 157
104 3300005841 Ga0068863_100005564 Ga0068863_1000055642 157
105 3300005843 Ga0068860_100020466 Ga0068860_1000204662 157
106 3300005843 Ga0068860_101265281 Ga0068860_1012652812 157
107 3300005844 Ga0068862_100114867 Ga0068862_1001148672 157
108 3300006051 Ga0075364_10002886 Ga0075364_100028869 157
109 3300006353 Ga0075370_10000003 Ga0075370_10000003140 157
110 3300006353 Ga0075370_10076736 Ga0075370_100767362 157
111 3300006353 Ga0075370_10522263 Ga0075370_105222631 157
112 3300009093 Ga0105240_11634316 Ga0105240_116343162 157
113 3300013102 Ga0157371_10493411 Ga0157371_104934112 157
114 3300025925 Ga0207650_10178418 Ga0207650_101784182 157
115 3300025931 Ga0207644_10461375 Ga0207644_104613752 157
116 3300025931 Ga0207644_11238608 Ga0207644_112386081 157
117 3300025981 Ga0207640_10001190 Ga0207640_1000119010 157
118 3300025986 Ga0207658_10001511 Ga0207658_1000151115 157
119 3300026088 Ga0207641_10050390 Ga0207641_100503902 157
120 3300026116 Ga0207674_10167737 Ga0207674_101677371 157
121 3300026118 Ga0207675_100115266 Ga0207675_1001152665 157
122 3300026142 Ga0207698_10257154 Ga0207698_102571542 157
123 3300028379 Ga0268266_10084111 Ga0268266_100841113 157
124 3300028379 Ga0268266_11860460 Ga0268266_118604601 157
125 3300028381 Ga0268264_10039388 Ga0268264_100393885 157
126 3300031548 Ga0307408_100406048 Ga0307408_1004060482 157
127 3300031731 Ga0307405_10000277 Ga0307405_1000027711 157
128 3300031824 Ga0307413_10155764 Ga0307413_101557642 157
129 3300031852 Ga0307410_10592402 Ga0307410_105924022 157
130 3300031901 Ga0307406_10161310 Ga0307406_101613103 157
131 3300031911 Ga0307412_10801898 Ga0307412_108018982 157
132 3300032005 Ga0307411_10977235 Ga0307411_109772351 157
133 3300032126 Ga0307415_101357866 Ga0307415_1013578661 157
134 3300045051 Ga0451576_0000007 Ga0451576_0000007_164515_165012 157
135 3300046530 Ga0495654_0036597 Ga0495654_0036597_1734_2207 157
136 3300046616 Ga0495668_0129801 Ga0495668_0129801_881_1354 157
137 3300046616 Ga0495668_0285580 Ga0495668_0285580_345_827 157
138 3300046660 Ga0495625_0030329 Ga0495625_0030329_3285_3758 157
139 3300046691 Ga0495670_0200451 Ga0495670_0200451_463_936 157
140 3300048906 Ga0496103_0256149 Ga0496103_0256149_557_1048 157
141 3300048907 Ga0496104_0019858 Ga0496104_0019858_3644_4135 157
142 3300048908 Ga0496105_0021244 Ga0496105_0021244_662_1153 157
143 3300048922 Ga0496119_0199100 Ga0496119_0199100_488_979 157
144 3300048924 Ga0496121_0356073 Ga0496121_0356073_421_912 157
145 3300049571 Ga0501034_0444109 Ga0501034_0444109_302_796 157
146 3300049578 Ga0501042_0105101 Ga0501042_0105101_1320_1811 157
147 3300049823 Ga0501044_0560590 Ga0501044_0560590_99_590 157
148 3300049823 Ga0501044_0602291 Ga0501044_0602291_296_781 157
149 3300049823 Ga0501044_0806559 Ga0501044_0806559_289_774 157
150 3300050491 nmdc:mga00v17_27175_c1 nmdc:mga00v17_27175_c1_372_845 157
151 3300050496 nmdc:mga07m45_34700_c1 nmdc:mga07m45_34700_c1_847_1332 157
152 3300050496 nmdc:mga07m45_6_c1 nmdc:mga07m45_6_c1_8098_8622 157
153 3300053096 Ga0500641_0015509 Ga0500641_0015509_1223_1735 157
154 3300053121 Ga0500607_001004 Ga0500607_001004_5887_6369 157
155 3300053122 Ga0500608_337231 Ga0500608_337231_31_504 157
156 3300053136 Ga0500559_0002165 Ga0500559_0002165_4109_4591 157
157 3300053148 Ga0500590_122133 Ga0500590_122133_45_527 157
158 3300053730 Ga0500645_001536 Ga0500645_001536_1569_2051 157
159 3300059477 Ga0587084_000985 Ga0587084_000985_766_1254 157
160 3300059491 Ga0587070_003853 Ga0587070_003853_81_569 157
161 3300059504 Ga0587082_005583 Ga0587082_005583_504_992 157
162 3300059510 Ga0587090_001637 Ga0587090_001637_1283_1771 157
163 3300060346 Ga0587111_0005108 Ga0587111_0005108_163_651 157
164 iso_pu_bacteria 2882806704 2882807906 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03358

FMN_red

NADPH-dependent FMN reductase

56

137

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ohh-assembly1.cif.gz_A crystal structure of coenzyme f420h2 oxidase (fpra), a diiron flavoprotein, active oxidized state 0.8417 2 150
3nll-assembly1.cif.gz_A clostridium beijerinckii flavodoxin mutant: g57a oxidized 0.8301 1 150
1zwk-assembly1.cif.gz_A structure of wrba from pseudomonas aeruginosa 0.8293 2 150
4nll-assembly1.cif.gz_A clostridium beijerinckii flavodoxin mutant: g57d oxidized 0.8285 1 150
5wid-assembly2.cif.gz_B structure of a flavodoxin from the domain archaea 0.8269 1 153
ID Description Score Start End Superfamily
af_O33313_1_149_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8541 2 152 3.40.50.360
2ohhA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8431 1 150 3.40.50.360
2ohhA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8324 1 150 3.40.50.360
af_O33313_1_149_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8274 2 152 3.40.50.360
1flnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8232 1 150 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A653J1D2-F1-model_v4 Flavodoxin 0.9873 1 157 GO:0010181
GO:0016491
AF-A0A7W7NU92-F1-model_v4 Flavodoxin-like domain-containing protein 0.9856 1 157 GO:0010181
GO:0016491
AF-A0A0W1DDQ8-F1-model_v4 Flavodoxin 0.9814 2 157 GO:0016491
AF-A0A7X1FWY3-F1-model_v4 Flavodoxin family protein 0.9808 2 157 GO:0016491
AF-A0A7W7NU92-F1-model_v4 Flavodoxin-like domain-containing protein 0.9794 1 157 GO:0010181
GO:0016491

Feature Viewer

pLDDT pTM Quality
92.36 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map