F244764

General Info

Members Datasets Scaffolds Average Seq Length
164 128 328 156

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0012005|Ga0501031_0012005_4347_4880
Length 177
Sequence MVARRIAIAYRDMQPNVAESGSKMEYGSIEREIHVDASPEVVFEVVSRPEHIRQWWPDEADIEPTPGAVGQLVWKDDATGHAEVVPITVVDVEPPRRFSFRWVHPEDEVATPSNSLLVTFELQPSGGGTMVRLTETGFREKGWEAAVLEEQYHEHCVGWDWYLPRLGEYATRLVSTP

Samples

Sample ID Description Type Environment
1 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
13 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
14 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
15 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
18 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
19 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
20 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
21 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
22 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
23 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
26 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
27 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
28 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
29 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
30 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
33 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
48 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
49 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
50 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
51 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
52 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
53 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
54 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
55 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
56 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
57 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
58 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
59 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
60 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
61 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
62 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
63 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
64 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
65 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
66 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
67 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
68 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
69 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
70 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
71 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
72 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
73 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
74 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
75 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
76 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
77 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
78 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
79 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
80 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
81 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
82 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
83 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
84 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
92 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
93 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
94 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
95 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
96 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
97 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
98 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
99 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
100 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
101 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
103 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
104 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
105 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
106 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
107 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
108 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
109 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
110 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
111 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
112 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
113 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
114 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
115 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
116 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
117 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
118 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
119 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
120 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
121 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
122 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
123 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
124 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
125 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
126 8002775197 Frankia nepalensis CN7 Isolate Nodule
127 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
128 8054920844 Frankia tisae Agncl-8 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.51
Metatranscriptomes 0.61
Isolates 4.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.24
Nodule 1.22
Rhizoplane 11.59
Rhizosphere 62.8
Stem 0
Stem Tuber 0
Unclassified 1.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501031_0012005 3300049568 Bacteria 5648
2 Ga0070680_100175941 3300005336 Bacteria 1802
3 Ga0070680_100884973 3300005336 Bacteria 770
4 Ga0068868_100145435 3300005338 Bacteria 1949
5 Ga0070668_100001789 3300005347 Bacteria 15625
6 Ga0070667_100358634 3300005367 Bacteria 1321
7 Ga0070703_10081284 3300005406 Bacteria 1104
8 Ga0070713_100318845 3300005436 Bacteria 1435
9 Ga0070708_100716257 3300005445 Bacteria 941
10 Ga0070663_100000648 3300005455 Bacteria 18651
11 Ga0070678_100770368 3300005456 Bacteria 872
12 Ga0070678_101865421 3300005456 Bacteria 567
13 Ga0070684_101537309 3300005535 Bacteria 627
14 Ga0070704_100079592 3300005549 Bacteria 2408
15 Ga0068859_100006110 3300005617 Bacteria 12230
16 Ga0068861_101982549 3300005719 Bacteria 580
17 Ga0068858_101217066 3300005842 Bacteria 740
18 Ga0068858_101296114 3300005842 Bacteria 717
19 Ga0081455_10050589 3300005937 Bacteria 3572
20 Ga0081455_10244395 3300005937 Bacteria 1317
21 Ga0075365_10100360 3300006038 Bacteria 1981
22 Ga0075365_10318031 3300006038 Bacteria 1096
23 Ga0075365_10523926 3300006038 Bacteria 838
24 Ga0075364_10045520 3300006051 Bacteria 2856
25 Ga0075364_10176501 3300006051 Bacteria 1445
26 Ga0075367_10223285 3300006178 Bacteria 1179
27 Ga0075369_10429717 3300006186 Bacteria 624
28 Ga0075370_10048649 3300006353 Bacteria 2402
29 Ga0075370_10193071 3300006353 Bacteria 1200
30 Ga0075370_10383422 3300006353 Unclassified 842
31 Ga0075431_100004850 3300006847 Bacteria 13248
32 Ga0075431_100321960 3300006847 Bacteria 1559
33 Ga0075431_100668192 3300006847 Bacteria 1018
34 Ga0097620_100006110 3300006931 Bacteria 12230
35 Ga0114129_10252258 3300009147 Bacteria 2368
36 Ga0105242_10032031 3300009176 Bacteria 4203
37 Ga0105248_10000079 3300009177 Bacteria 111571
38 Ga0105238_12558918 3300009551 Bacteria 546
39 Ga0105249_13346632 3300009553 Bacteria 516
40 Ga0157374_11369687 3300013296 Bacteria 730
41 Ga0157372_11072757 3300013307 Bacteria 932
42 Ga0157375_10189623 3300013308 Bacteria 2210
43 Ga0183367_1015 3300015688 Bacteria 298435
44 Ga0206353_10323317 3300020082 Bacteria 1141
45 Ga0207710_10002869 3300025900 Bacteria 7843
46 Ga0207705_10660990 3300025909 Bacteria 813
47 Ga0207671_10506152 3300025914 Bacteria 963
48 Ga0207700_10274208 3300025928 Bacteria 1449
49 Ga0207686_10326447 3300025934 Bacteria 1148
50 Ga0207711_10000072 3300025941 Bacteria 112054
51 Ga0207661_10165069 3300025944 Bacteria 1924
52 Ga0207668_10007889 3300025972 Bacteria 6327
53 Ga0207658_10960141 3300025986 Bacteria 779
54 Ga0207703_10999052 3300026035 Bacteria 803
55 Ga0207678_10000091 3300026067 Bacteria 75052
56 Ga0207702_10294077 3300026078 Bacteria 1539
57 Ga0207683_10345354 3300026121 Bacteria 1365
58 Ga0307515_10171985 3300028794 Bacteria 2155
59 Ga0307413_11518733 3300031824 Bacteria 593
60 Ga0307412_11723350 3300031911 Bacteria 575
61 Ga0307409_100049031 3300031995 Bacteria 3218
62 Ga0307409_100345428 3300031995 Bacteria 1402
63 Ga0307416_101646726 3300032002 Bacteria 747
64 Ga0451791_1359375 3300041451 Bacteria 947
65 Ga0451833_1466715 3300041491 Bacteria 741
66 Ga0451853_2104869 3300041512 Bacteria 1178
67 Ga0451853_3994325 3300041512 Bacteria 739
68 Ga0439448_0096127 3300042005 Unclassified 1004
69 Ga0466965_0006348 3300044683 Bacteria 5360
70 Ga0466965_0031625 3300044683 Bacteria 2582
71 Ga0466964_0155546 3300044706 Bacteria 1064
72 Ga0466971_0192692 3300044719 Bacteria 961
73 Ga0466970_0105039 3300044765 Bacteria 1540
74 Ga0466970_0174237 3300044765 Bacteria 1193
75 Ga0466957_1141485 3300044842 Bacteria 563
76 Ga0466960_0215039 3300044901 Bacteria 1055
77 Ga0466960_0292527 3300044901 Bacteria 916
78 Ga0466960_0469096 3300044901 Bacteria 734
79 Ga0466960_0811451 3300044901 Bacteria 567
80 Ga0466958_0542444 3300045836 Bacteria 755
81 Ga0466967_1692461 3300045976 Bacteria 630
82 Ga0495641_0195579 3300046461 Bacteria 906
83 Ga0495687_025859 3300047443 Bacteria 2768
84 Ga0495593_0276126 3300047673 Bacteria 841
85 Ga0496102_0000095 3300048905 Bacteria 124981
86 Ga0496102_0004260 3300048905 Bacteria 12094
87 Ga0496102_0015586 3300048905 Bacteria 6622
88 Ga0496103_0000084 3300048906 Bacteria 105728
89 Ga0496103_0001008 3300048906 Bacteria 19706
90 Ga0496107_1056171 3300048910 Bacteria 588
91 Ga0496108_0002510 3300048911 Bacteria 14672
92 Ga0496108_0353981 3300048911 Bacteria 1281
93 Ga0496109_0000167 3300048912 Bacteria 64493
94 Ga0496109_0083805 3300048912 Bacteria 2940
95 Ga0496109_0684236 3300048912 Bacteria 963
96 Ga0496110_0403819 3300048913 Bacteria 1245
97 Ga0496111_0090577 3300048914 Bacteria 2241
98 Ga0496111_0496818 3300048914 Bacteria 898
99 Ga0496112_0978927 3300048915 Bacteria 766
100 Ga0496113_0366219 3300048916 Bacteria 1157
101 Ga0496114_0114613 3300048917 Bacteria 2311
102 Ga0496114_0574553 3300048917 Bacteria 995
103 Ga0496117_0053213 3300048920 Bacteria 2846
104 Ga0496118_0004290 3300048921 Bacteria 17062
105 Ga0496118_0018322 3300048921 Bacteria 6321
106 Ga0496120_0189781 3300048923 Unclassified 1003
107 Ga0496121_0091821 3300048924 Bacteria 2369
108 Ga0496125_0109646 3300048928 Bacteria 2003
109 Ga0496126_0000006 3300048929 Bacteria 798804
110 Ga0501033_0847706 3300049570 Bacteria 616
111 Ga0501036_0007088 3300049572 Bacteria 9118
112 Ga0501039_0035680 3300049575 Bacteria 3838
113 Ga0501041_0005509 3300049577 Bacteria 7402
114 Ga0501042_0465958 3300049578 Bacteria 917
115 Ga0501043_0058305 3300049579 Bacteria 3031
116 Ga0501046_0072626 3300049580 Bacteria 2671
117 Ga0501046_0413762 3300049580 Bacteria 973
118 Ga0501048_0411999 3300049582 Bacteria 966
119 Ga0501068_0020934 3300049584 Bacteria 3817
120 Ga0501071_0011033 3300049587 Bacteria 6069
121 Ga0501071_0587542 3300049587 Bacteria 856
122 Ga0501072_0005673 3300049588 Bacteria 9504
123 Ga0501073_0379286 3300049589 Bacteria 977
124 Ga0501074_0077398 3300049590 Bacteria 2387
125 Ga0501075_0006563 3300049591 Bacteria 8012
126 Ga0501076_0153193 3300049592 Bacteria 1875
127 Ga0501077_0108080 3300049593 Bacteria 1762
128 Ga0501079_0255575 3300049741 Bacteria 1369
129 Ga0501081_0305719 3300049743 Bacteria 1167
130 Ga0501035_0148733 3300049822 Bacteria 2033
131 Ga0501044_0322494 3300049823 Bacteria 1469
132 nmdc:mga03n38_148134_c1 3300050490 Bacteria 1179
133 nmdc:mga00v17_116262_c1 3300050491 Bacteria 1700
134 nmdc:mga00v17_43205_c1 3300050491 Bacteria 2713
135 nmdc:mga0yw44_101385_c1 3300050492 Bacteria 1834
136 nmdc:mga0yw44_29503_c1 3300050492 Bacteria 3167
137 nmdc:mga0yw44_362839_c1 3300050492 Bacteria 976
138 nmdc:mga07m45_188090_c1 3300050496 Bacteria 1200
139 nmdc:mga07m45_47934_c1 3300050496 Bacteria 2402
140 nmdc:mga05p37_216346_c1 3300050507 Bacteria 2314
141 nmdc:mga06r32_10606_c1 3300050510 Bacteria 8310
142 nmdc:mga06r32_304126_c1 3300050510 Bacteria 1580
143 nmdc:mga06r32_647161_c1 3300050510 Bacteria 1025
144 nmdc:mga0rr50_236673_c1 3300050513 Bacteria 1512
145 nmdc:mga0sz30_268654_c1 3300050516 Bacteria 759
146 Ga0500635_0240776 3300053080 Bacteria 708
147 Ga0500583_0143984 3300053092 Bacteria 1185
148 Ga0500556_0001949 3300053104 Bacteria 7285
149 Ga0500593_000079 3300053117 Bacteria 35855
150 Ga0500559_0252069 3300053136 Bacteria 832
151 Ga0500604_0005501 3300053151 Bacteria 3345
152 Ga0501084_0106254 3300054114 Bacteria 2358
153 Ga0501082_0357186 3300060353 Bacteria 1274
154 Ga0466962_0165914 3300061719 Bacteria 1074
155 Ga0530510_0107072 3300061734 Bacteria 2046
156 Ga0530510_0139220 3300061734 Bacteria 1787
157 2644505933 2643221690 Bacteria 4654705
158 2645719686 2643221961 Bacteria 3919167
159 2645726572 2643221962 Bacteria 3874254
160 2816425958 2816332119 Bacteria 8120218
161 2862286503 2862281513 Bacteria 9621493
162 8002782962 8002775197 Bacteria 10728764
163 8003320052 8003314358 Bacteria 10575343
164 8054920859 8054920844 Bacteria 7068637
165 Ga0501031_0012005
166 Ga0070680_100175941
167 Ga0070680_100884973
168 Ga0068868_100145435
169 Ga0070668_100001789
170 Ga0070667_100358634
171 Ga0070703_10081284
172 Ga0070713_100318845
173 Ga0070708_100716257
174 Ga0070663_100000648
175 Ga0070678_100770368
176 Ga0070678_101865421
177 Ga0070684_101537309
178 Ga0070704_100079592
179 Ga0068859_100006110
180 Ga0068861_101982549
181 Ga0068858_101217066
182 Ga0068858_101296114
183 Ga0081455_10050589
184 Ga0081455_10244395
185 Ga0075365_10100360
186 Ga0075365_10318031
187 Ga0075365_10523926
188 Ga0075364_10045520
189 Ga0075364_10176501
190 Ga0075367_10223285
191 Ga0075369_10429717
192 Ga0075370_10048649
193 Ga0075370_10193071
194 Ga0075370_10383422
195 Ga0075431_100004850
196 Ga0075431_100321960
197 Ga0075431_100668192
198 Ga0097620_100006110
199 Ga0114129_10252258
200 Ga0105242_10032031
201 Ga0105248_10000079
202 Ga0105238_12558918
203 Ga0105249_13346632
204 Ga0157374_11369687
205 Ga0157372_11072757
206 Ga0157375_10189623
207 Ga0183367_1015
208 Ga0206353_10323317
209 Ga0207710_10002869
210 Ga0207705_10660990
211 Ga0207671_10506152
212 Ga0207700_10274208
213 Ga0207686_10326447
214 Ga0207711_10000072
215 Ga0207661_10165069
216 Ga0207668_10007889
217 Ga0207658_10960141
218 Ga0207703_10999052
219 Ga0207678_10000091
220 Ga0207702_10294077
221 Ga0207683_10345354
222 Ga0307515_10171985
223 Ga0307413_11518733
224 Ga0307412_11723350
225 Ga0307409_100049031
226 Ga0307409_100345428
227 Ga0307416_101646726
228 Ga0451791_1359375
229 Ga0451833_1466715
230 Ga0451853_2104869
231 Ga0451853_3994325
232 Ga0439448_0096127
233 Ga0466965_0006348
234 Ga0466965_0031625
235 Ga0466964_0155546
236 Ga0466971_0192692
237 Ga0466970_0105039
238 Ga0466970_0174237
239 Ga0466957_1141485
240 Ga0466960_0215039
241 Ga0466960_0292527
242 Ga0466960_0469096
243 Ga0466960_0811451
244 Ga0466958_0542444
245 Ga0466967_1692461
246 Ga0495641_0195579
247 Ga0495687_025859
248 Ga0495593_0276126
249 Ga0496102_0000095
250 Ga0496102_0004260
251 Ga0496102_0015586
252 Ga0496103_0000084
253 Ga0496103_0001008
254 Ga0496107_1056171
255 Ga0496108_0002510
256 Ga0496108_0353981
257 Ga0496109_0000167
258 Ga0496109_0083805
259 Ga0496109_0684236
260 Ga0496110_0403819
261 Ga0496111_0090577
262 Ga0496111_0496818
263 Ga0496112_0978927
264 Ga0496113_0366219
265 Ga0496114_0114613
266 Ga0496114_0574553
267 Ga0496117_0053213
268 Ga0496118_0004290
269 Ga0496118_0018322
270 Ga0496120_0189781
271 Ga0496121_0091821
272 Ga0496125_0109646
273 Ga0496126_0000006
274 Ga0501033_0847706
275 Ga0501036_0007088
276 Ga0501039_0035680
277 Ga0501041_0005509
278 Ga0501042_0465958
279 Ga0501043_0058305
280 Ga0501046_0072626
281 Ga0501046_0413762
282 Ga0501048_0411999
283 Ga0501068_0020934
284 Ga0501071_0011033
285 Ga0501071_0587542
286 Ga0501072_0005673
287 Ga0501073_0379286
288 Ga0501074_0077398
289 Ga0501075_0006563
290 Ga0501076_0153193
291 Ga0501077_0108080
292 Ga0501079_0255575
293 Ga0501081_0305719
294 Ga0501035_0148733
295 Ga0501044_0322494
296 nmdc:mga03n38_148134_c1
297 nmdc:mga00v17_116262_c1
298 nmdc:mga00v17_43205_c1
299 nmdc:mga0yw44_101385_c1
300 nmdc:mga0yw44_29503_c1
301 nmdc:mga0yw44_362839_c1
302 nmdc:mga07m45_188090_c1
303 nmdc:mga07m45_47934_c1
304 nmdc:mga05p37_216346_c1
305 nmdc:mga06r32_10606_c1
306 nmdc:mga06r32_304126_c1
307 nmdc:mga06r32_647161_c1
308 nmdc:mga0rr50_236673_c1
309 nmdc:mga0sz30_268654_c1
310 Ga0500635_0240776
311 Ga0500583_0143984
312 Ga0500556_0001949
313 Ga0500593_000079
314 Ga0500559_0252069
315 Ga0500604_0005501
316 Ga0501084_0106254
317 Ga0501082_0357186
318 Ga0466962_0165914
319 Ga0530510_0107072
320 Ga0530510_0139220
321 2644505933
322 2645719686
323 2645726572
324 2816425958
325 2862286503
326 8002782962
327 8003320052
328 8054920859

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

36

171

0.82

PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

26

154

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3q63-assembly2.cif.gz_D x-ray crystal structure of protein mll2253 from mesorhizobium loti, northeast structural genomics consortium target mlr404. 0.868 5 148
6v04-assembly1.cif.gz_A dynu16 crystal structure, a putative protein in the dynemicin biosynthetic locus 0.8493 4 150
2luz-assembly1.cif.gz_A solution nmr structure of calu16 from micromonospora echinospora, northeast structural genomics consortium (nesg) target mir12 0.8436 5 153
8es5-assembly1.cif.gz_B aha1 domain protein from pseudomonas aeruginosa 0.8431 5 143
3q63-assembly2.cif.gz_D x-ray crystal structure of protein mll2253 from mesorhizobium loti, northeast structural genomics consortium target mlr404. 0.838 5 148
ID Description Score Start End Superfamily
2luzA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8436 5 153 3.30.530.20
af_O53773_104_241_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8257 7 153 3.30.530.20
3q63F00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8242 1 148 3.30.530.20
af_Q8N9S3_197_326_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8213 5 113 3.30.530.20
af_Q9V9Q4_218_347_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8085 5 148 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A7J9V8T4-F1-model_v4 Polyketide cyclase 0.9889 1 138
AF-A0A5M3XK56-F1-model_v4 Activator of HSP90 ATPase 0.9855 1 153
AF-A0A7J9V8T4-F1-model_v4 Polyketide cyclase 0.9816 1 138
AF-A0A5M3XK56-F1-model_v4 Activator of HSP90 ATPase 0.9791 1 153
AF-K0EXC7-F1-model_v4 Activator of Hsp90 ATPase 1 family protein 0.9729 1 150

Map