F244654

General Info

Members Datasets Scaffolds Average Seq Length
164 118 164 175

Family's Representative Sequence

Representative Sequence 3300046692|Ga0495671_0451702|Ga0495671_0451702_62_586
Length 174
Sequence MADFNQVLTPGDWQSGIVNTVVEITQGSNMKIEWDRERACFMLDRVEPMIFAKPCNYGFIPQTLDEDGDELDTLVVTGPIPTGVYLEAKVIGVLNFIDDGEADHKVVVVPADDRNTGDSINTLDDLGERWKQQIEHHFTHYKDLKKPGSTKVEGWGDVEAAKKIIEESINRYGK

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
29 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
42 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
43 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
44 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
51 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
71 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
74 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
75 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
76 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
77 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
78 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
79 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
80 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
81 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
82 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
83 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
84 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
85 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
86 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
87 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
88 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
89 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
90 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
93 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
94 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
95 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
96 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
97 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
98 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
99 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
100 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
101 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
102 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
103 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
104 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
105 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
106 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
107 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
108 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
109 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
110 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
111 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
112 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
113 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
114 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
115 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
116 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
117 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
118 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 34.15
Nodule 0
Rhizoplane 3.05
Rhizosphere 60.37
Stem 0
Stem Tuber 0
Unclassified 2.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000038 3300001915 Bacteria 31009
2 JGI24742J22300_10000006 3300002244 Bacteria 41202
3 rootH2_10254631 3300003320 Bacteria 4390
4 rootL2_10260349 3300003322 Bacteria 3447
5 rootH1_10344472 3300003323 Bacteria 1162
6 Ga0070658_10235491 3300005327 Unclassified 1551
7 Ga0070676_10000782 3300005328 Bacteria 15687
8 Ga0070690_100024372 3300005330 Unclassified 3720
9 Ga0070670_100627379 3300005331 Unclassified 963
10 Ga0070680_100001276 3300005336 Bacteria 18211
11 Ga0070680_101517393 3300005336 Bacteria 580
12 Ga0070682_100077080 3300005337 Bacteria 2147
13 Ga0070682_100396529 3300005337 Unclassified 1042
14 Ga0070674_100017064 3300005356 Bacteria 4558
15 Ga0070688_100092511 3300005365 Unclassified 1978
16 Ga0070667_101071421 3300005367 Bacteria 753
17 Ga0070681_10013092 3300005458 Bacteria 8238
18 Ga0070681_10149906 3300005458 Bacteria 2259
19 Ga0070681_11201106 3300005458 Bacteria 680
20 Ga0070685_10002053 3300005466 Bacteria 10422
21 Ga0070679_100000730 3300005530 Bacteria 28399
22 Ga0070679_100038365 3300005530 Bacteria 4762
23 Ga0070679_100145652 3300005530 Bacteria 2347
24 Ga0070686_100001746 3300005544 Bacteria 12170
25 Ga0070665_100019550 3300005548 Bacteria 6799
26 Ga0068855_100000003 3300005563 Bacteria 589862
27 Ga0070664_100558014 3300005564 Unclassified 1059
28 Ga0068861_100028631 3300005719 Bacteria 4066
29 Ga0068863_100520715 3300005841 Bacteria 1172
30 Ga0075365_10000958 3300006038 Unclassified 12253
31 Ga0075365_10029697 3300006038 Bacteria 3497
32 Ga0075365_10082475 3300006038 Bacteria 2180
33 Ga0075365_10972638 3300006038 Bacteria 598
34 Ga0075368_10042730 3300006042 Unclassified 1784
35 Ga0075364_10004175 3300006051 Bacteria 8289
36 Ga0075364_10016601 3300006051 Bacteria 4582
37 Ga0075364_10147968 3300006051 Bacteria 1582
38 Ga0075364_10706505 3300006051 Bacteria 688
39 Ga0075367_10000034 3300006178 Bacteria 29945
40 Ga0075367_10341019 3300006178 Unclassified 945
41 Ga0075369_10000005 3300006186 Bacteria 147699
42 Ga0075369_10000051 3300006186 Bacteria 29832
43 Ga0075366_10000001 3300006195 Bacteria 569172
44 Ga0075366_10000044 3300006195 Bacteria 45021
45 Ga0075366_10000083 3300006195 Bacteria 37001
46 Ga0075366_10000342 3300006195 Bacteria 21427
47 Ga0075366_10069694 3300006195 Bacteria 2093
48 Ga0097621_100001002 3300006237 Bacteria 19854
49 Ga0075370_10031895 3300006353 Bacteria 2943
50 Ga0068871_100000055 3300006358 Bacteria 62753
51 Ga0068871_100609681 3300006358 Bacteria 993
52 Ga0105240_10033473 3300009093 Bacteria 6639
53 Ga0111539_10030862 3300009094 Bacteria 6514
54 Ga0105245_10000002 3300009098 Bacteria 634374
55 Ga0105247_10361712 3300009101 Unclassified 1023
56 Ga0105243_10008792 3300009148 Bacteria 7735
57 Ga0105243_10495714 3300009148 Unclassified 1156
58 Ga0105241_10000003 3300009174 Bacteria 839043
59 Ga0105237_10706344 3300009545 Bacteria 1015
60 Ga0105238_10007284 3300009551 Bacteria 11077
61 Ga0105238_10492207 3300009551 Unclassified 1226
62 Ga0105033_100127 3300009986 Bacteria 5811
63 Ga0105030_109053 3300009987 Bacteria 849
64 Ga0157373_10000042 3300013100 Bacteria 113564
65 Ga0157371_10000937 3300013102 Bacteria 32624
66 Ga0157370_10102503 3300013104 Bacteria 2680
67 Ga0157369_10000261 3300013105 Bacteria 71207
68 Ga0157369_10089735 3300013105 Bacteria 3282
69 Ga0157369_10438376 3300013105 Unclassified 1353
70 Ga0157374_10000031 3300013296 Bacteria 204840
71 Ga0157374_10250028 3300013296 Bacteria 1744
72 Ga0157374_12072824 3300013296 Bacteria 595
73 Ga0157372_10000194 3300013307 Bacteria 66925
74 Ga0157372_10763788 3300013307 Bacteria 1124
75 Ga0157380_10425314 3300014326 Bacteria 1268
76 Ga0157377_10048131 3300014745 Bacteria 2391
77 Ga0207645_10005159 3300025907 Bacteria 9544
78 Ga0207705_10186777 3300025909 Unclassified 1566
79 Ga0207654_10000002 3300025911 Bacteria 1460142
80 Ga0207707_10035204 3300025912 Bacteria 4379
81 Ga0207671_10945321 3300025914 Unclassified 680
82 Ga0207660_10020469 3300025917 Bacteria 4440
83 Ga0207662_10607528 3300025918 Bacteria 761
84 Ga0207652_10003903 3300025921 Bacteria 12193
85 Ga0207652_10024398 3300025921 Bacteria 5017
86 Ga0207652_10070130 3300025921 Bacteria 3043
87 Ga0207694_10004584 3300025924 Bacteria 10769
88 Ga0207687_10000001 3300025927 Bacteria 1130810
89 Ga0207644_10086065 3300025931 Unclassified 2333
90 Ga0207709_10014139 3300025935 Bacteria 4406
91 Ga0207709_10365517 3300025935 Unclassified 1093
92 Ga0207669_10009507 3300025937 Bacteria 4636
93 Ga0207679_10520407 3300025945 Unclassified 1064
94 Ga0207667_10000008 3300025949 Bacteria 625138
95 Ga0207667_10031525 3300025949 Bacteria 5722
96 Ga0207667_10220052 3300025949 Bacteria 1945
97 Ga0207678_10279416 3300026067 Bacteria 1433
98 Ga0207641_10033583 3300026088 Bacteria 4262
99 Ga0207674_10114575 3300026116 Bacteria 2668
100 Ga0207674_10138227 3300026116 Bacteria 2397
101 Ga0207674_10509464 3300026116 Bacteria 1162
102 Ga0209998_10034733 3300027717 Unclassified 1128
103 Ga0209813_10025727 3300027866 Bacteria 1695
104 Ga0207428_10060283 3300027907 Unclassified 3006
105 Ga0268266_10001150 3300028379 Bacteria 32834
106 Ga0316179_1091940 3300030734 Unclassified 2354
107 Ga0373935_0491413 3300035692 Bacteria 890
108 Ga0395900_0024461 3300037418 Bacteria 6185
109 Ga0395905_0002005 3300037471 Bacteria 23268
110 Ga0395901_0001919 3300038443 Bacteria 21405
111 Ga0395901_1128696 3300038443 Bacteria 753
112 Ga0451798_0704171 3300041458 Bacteria 840
113 Ga0451802_0166102 3300041460 Unclassified 1665
114 Ga0451833_1262330 3300041491 Unclassified 1200
115 Ga0453683_0624544 3300044673 Bacteria 703
116 Ga0495588_0000116 3300046674 Bacteria 135919
117 Ga0495671_0451702 3300046692 Bacteria 614
118 Ga0495589_0267501 3300046794 Bacteria 796
119 Ga0495676_0201225 3300047321 Bacteria 1384
120 Ga0495686_0376657 3300047472 Bacteria 766
121 Ga0496100_0040985 3300048903 Unclassified 2949
122 Ga0496109_0263775 3300048912 Bacteria 1623
123 Ga0496112_0153491 3300048915 Bacteria 2270
124 Ga0501034_0001444 3300049571 Bacteria 31518
125 Ga0501046_0053953 3300049580 Unclassified 3164
126 Ga0501234_001501 3300049707 Bacteria 3666
127 Ga0501080_0565927 3300049742 Bacteria 1011
128 nmdc:mga00v17_33330_c1 3300050491 Bacteria 3051
129 nmdc:mga00v17_3973_c1 3300050491 Bacteria 7629
130 nmdc:mga00v17_76_c2 3300050491 Bacteria 52505
131 nmdc:mga00v17_815153_c1 3300050491 Bacteria 594
132 nmdc:mga0yw44_1088_c1 3300050492 Bacteria 10445
133 nmdc:mga0yw44_261639_c1 3300050492 Bacteria 1153
134 nmdc:mga0yw44_29003_c1 3300050492 Bacteria 3190
135 nmdc:mga0k408_114_c1 3300050493 Bacteria 39328
136 nmdc:mga0k408_17_c2 3300050493 Bacteria 97852
137 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
138 nmdc:mga0k408_447_c1 3300050493 Bacteria 22558
139 nmdc:mga0k408_78298_c2 3300050493 Bacteria 785
140 nmdc:mga06z11_2011_c1 3300050494 Bacteria 7703
141 nmdc:mga04h51_26015_c1 3300050495 Unclassified 1806
142 nmdc:mga07m45_346537_c1 3300050496 Unclassified 863
143 nmdc:mga08y16_15042_c1 3300050511 Bacteria 8137
144 nmdc:mga0sz30_23_c1 3300050516 Bacteria 65683
145 Ga0500643_000038 3300053087 Bacteria 178974
146 Ga0500643_001206 3300053087 Bacteria 15437
147 Ga0500644_0000754 3300053088 Bacteria 11122
148 Ga0500646_0000290 3300053090 Bacteria 15407
149 Ga0500583_0093446 3300053092 Bacteria 1466
150 Ga0500651_0173560 3300053093 Bacteria 1284
151 Ga0500650_0000001 3300053098 Bacteria 818797
152 Ga0500556_0002083 3300053104 Bacteria 6890
153 Ga0500562_024986 3300053108 Bacteria 1562
154 Ga0500594_0000001 3300053118 Bacteria 1178472
155 Ga0500614_000001 3300053123 Bacteria 1274484
156 Ga0500655_000436 3300053133 Bacteria 8576
157 Ga0500577_0001431 3300053142 Bacteria 6111
158 Ga0500577_0003251 3300053142 Bacteria 4209
159 Ga0500579_005844 3300053143 Bacteria 7590
160 Ga0500649_000013 3300053722 Bacteria 73694
161 Ga0500570_008025 3300053724 Bacteria 5814
162 Ga0500611_000230 3300053727 Bacteria 6454
163 Ga0500611_010198 3300053727 Bacteria 1515
164 Ga0500599_026868 3300053736 Unclassified 841

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046794 Ga0495589_0267501 Ga0495589_0267501_27_479 149
2 3300044673 Ga0453683_0624544 Ga0453683_0624544_226_693 155
3 3300006186 Ga0075369_10000051 Ga0075369_1000005111 158
4 3300006195 Ga0075366_10000001 Ga0075366_10000001472 158
5 3300046674 Ga0495588_0000116 Ga0495588_0000116_120141_120677 158
6 3300047321 Ga0495676_0201225 Ga0495676_0201225_769_1305 158
7 3300050493 nmdc:mga0k408_1_c1 nmdc:mga0k408_1_c1_643325_643855 158
8 3300050516 nmdc:mga0sz30_23_c1 nmdc:mga0sz30_23_c1_49475_50005 158
9 3300053123 Ga0500614_000001 Ga0500614_000001_318672_319208 158
10 3300053722 Ga0500649_000013 Ga0500649_000013_66751_67287 158
11 3300041458 Ga0451798_0704171 Ga0451798_0704171_341_823 160
12 3300050491 nmdc:mga00v17_815153_c1 nmdc:mga00v17_815153_c1_71_583 170
13 3300026116 Ga0207674_10509464 Ga0207674_105094642 171
14 3300003320 rootH2_10254631 rootH2_102546313 174
15 3300005331 Ga0070670_100627379 Ga0070670_1006273792 174
16 3300046692 Ga0495671_0451702 Ga0495671_0451702_62_586 174
17 3300053088 Ga0500644_0000754 Ga0500644_0000754_4389_4913 174
18 3300053142 Ga0500577_0001431 Ga0500577_0001431_4284_4808 174
19 3300053727 Ga0500611_000230 Ga0500611_000230_1104_1628 174
20 3300005458 Ga0070681_10013092 Ga0070681_1001309210 175
21 3300006195 Ga0075366_10069694 Ga0075366_100696942 175
22 3300006358 Ga0068871_100609681 Ga0068871_1006096811 175
23 3300013296 Ga0157374_10250028 Ga0157374_102500282 175
24 3300025912 Ga0207707_10035204 Ga0207707_100352044 175
25 3300035692 Ga0373935_0491413 Ga0373935_0491413_327_854 175
26 3300037471 Ga0395905_0002005 Ga0395905_0002005_4849_5376 175
27 3300038443 Ga0395901_0001919 Ga0395901_0001919_10314_10841 175
28 3300038443 Ga0395901_1128696 Ga0395901_1128696_77_604 175
29 3300041491 Ga0451833_1262330 Ga0451833_1262330_276_803 175
30 3300048903 Ga0496100_0040985 Ga0496100_0040985_190_717 175
31 3300050493 nmdc:mga0k408_78298_c2 nmdc:mga0k408_78298_c2_91_618 175
32 3300053087 Ga0500643_001206 Ga0500643_001206_9746_10273 175
33 3300053724 Ga0500570_008025 Ga0500570_008025_3805_4332 175
34 3300003322 rootL2_10260349 rootL2_102603493 176
35 3300003323 rootH1_10344472 rootH1_103444721 176
36 3300005327 Ga0070658_10235491 Ga0070658_102354912 176
37 3300005330 Ga0070690_100024372 Ga0070690_1000243722 176
38 3300005336 Ga0070680_100001276 Ga0070680_1000012766 176
39 3300005336 Ga0070680_101517393 Ga0070680_1015173931 176
40 3300005367 Ga0070667_101071421 Ga0070667_1010714212 176
41 3300005458 Ga0070681_10149906 Ga0070681_101499063 176
42 3300005458 Ga0070681_11201106 Ga0070681_112011061 176
43 3300005530 Ga0070679_100000730 Ga0070679_10000073013 176
44 3300005530 Ga0070679_100038365 Ga0070679_1000383654 176
45 3300005530 Ga0070679_100145652 Ga0070679_1001456522 176
46 3300005544 Ga0070686_100001746 Ga0070686_10000174613 176
47 3300005841 Ga0068863_100520715 Ga0068863_1005207152 176
48 3300006038 Ga0075365_10000958 Ga0075365_100009582 176
49 3300006038 Ga0075365_10029697 Ga0075365_100296972 176
50 3300006038 Ga0075365_10972638 Ga0075365_109726381 176
51 3300006051 Ga0075364_10004175 Ga0075364_100041758 176
52 3300006051 Ga0075364_10147968 Ga0075364_101479682 176
53 3300006051 Ga0075364_10706505 Ga0075364_107065051 176
54 3300006178 Ga0075367_10341019 Ga0075367_103410192 176
55 3300006195 Ga0075366_10000044 Ga0075366_1000004443 176
56 3300006195 Ga0075366_10000342 Ga0075366_1000034210 176
57 3300009093 Ga0105240_10033473 Ga0105240_100334732 176
58 3300009148 Ga0105243_10495714 Ga0105243_104957141 176
59 3300009545 Ga0105237_10706344 Ga0105237_107063441 176
60 3300009551 Ga0105238_10007284 Ga0105238_100072842 176
61 3300013100 Ga0157373_10000042 Ga0157373_100000428 176
62 3300013104 Ga0157370_10102503 Ga0157370_101025032 176
63 3300013105 Ga0157369_10089735 Ga0157369_100897354 176
64 3300013296 Ga0157374_12072824 Ga0157374_120728241 176
65 3300013307 Ga0157372_10000194 Ga0157372_1000019465 176
66 3300014745 Ga0157377_10048131 Ga0157377_100481312 176
67 3300025909 Ga0207705_10186777 Ga0207705_101867772 176
68 3300025914 Ga0207671_10945321 Ga0207671_109453212 176
69 3300025917 Ga0207660_10020469 Ga0207660_100204692 176
70 3300025921 Ga0207652_10003903 Ga0207652_1000390314 176
71 3300025921 Ga0207652_10024398 Ga0207652_100243987 176
72 3300025921 Ga0207652_10070130 Ga0207652_100701304 176
73 3300025924 Ga0207694_10004584 Ga0207694_100045842 176
74 3300025931 Ga0207644_10086065 Ga0207644_100860653 176
75 3300025935 Ga0207709_10365517 Ga0207709_103655172 176
76 3300026088 Ga0207641_10033583 Ga0207641_100335835 176
77 3300026116 Ga0207674_10138227 Ga0207674_101382272 176
78 3300030734 Ga0316179_1091940 Ga0316179_10919402 176
79 3300037418 Ga0395900_0024461 Ga0395900_0024461_415_978 176
80 3300047472 Ga0495686_0376657 Ga0495686_0376657_129_659 176
81 3300048912 Ga0496109_0263775 Ga0496109_0263775_136_666 176
82 3300048915 Ga0496112_0153491 Ga0496112_0153491_1517_2047 176
83 3300049571 Ga0501034_0001444 Ga0501034_0001444_23991_24521 176
84 3300049580 Ga0501046_0053953 Ga0501046_0053953_1878_2408 176
85 3300049707 Ga0501234_001501 Ga0501234_001501_813_1343 176
86 3300049742 Ga0501080_0565927 Ga0501080_0565927_146_676 176
87 3300050491 nmdc:mga00v17_33330_c1 nmdc:mga00v17_33330_c1_1892_2422 176
88 3300050491 nmdc:mga00v17_76_c2 nmdc:mga00v17_76_c2_23311_23841 176
89 3300050492 nmdc:mga0yw44_1088_c1 nmdc:mga0yw44_1088_c1_81_611 176
90 3300050492 nmdc:mga0yw44_261639_c1 nmdc:mga0yw44_261639_c1_48_578 176
91 3300050492 nmdc:mga0yw44_29003_c1 nmdc:mga0yw44_29003_c1_339_869 176
92 3300050493 nmdc:mga0k408_114_c1 nmdc:mga0k408_114_c1_11758_12288 176
93 3300050493 nmdc:mga0k408_17_c2 nmdc:mga0k408_17_c2_10644_11174 176
94 3300053090 Ga0500646_0000290 Ga0500646_0000290_10130_10660 176
95 3300053093 Ga0500651_0173560 Ga0500651_0173560_43_573 176
96 3300053098 Ga0500650_0000001 Ga0500650_0000001_403785_404315 176
97 3300053104 Ga0500556_0002083 Ga0500556_0002083_5294_5827 176
98 3300053108 Ga0500562_024986 Ga0500562_024986_841_1371 176
99 3300053118 Ga0500594_0000001 Ga0500594_0000001_1064863_1065393 176
100 3300053133 Ga0500655_000436 Ga0500655_000436_2797_3327 176
101 3300053142 Ga0500577_0003251 Ga0500577_0003251_3550_4080 176
102 3300053143 Ga0500579_005844 Ga0500579_005844_6735_7265 176
103 3300053736 Ga0500599_026868 Ga0500599_026868_89_619 176
104 3300001915 JGI24741J21665_1000038 JGI24741J21665_100003822 177
105 3300002244 JGI24742J22300_10000006 JGI24742J22300_1000000617 177
106 3300005328 Ga0070676_10000782 Ga0070676_1000078216 177
107 3300005337 Ga0070682_100077080 Ga0070682_1000770801 177
108 3300005337 Ga0070682_100396529 Ga0070682_1003965291 177
109 3300005356 Ga0070674_100017064 Ga0070674_1000170643 177
110 3300005365 Ga0070688_100092511 Ga0070688_1000925113 177
111 3300005466 Ga0070685_10002053 Ga0070685_100020533 177
112 3300005548 Ga0070665_100019550 Ga0070665_1000195509 177
113 3300005563 Ga0068855_100000003 Ga0068855_10000000358 177
114 3300005564 Ga0070664_100558014 Ga0070664_1005580141 177
115 3300005719 Ga0068861_100028631 Ga0068861_1000286312 177
116 3300006038 Ga0075365_10082475 Ga0075365_100824752 177
117 3300006042 Ga0075368_10042730 Ga0075368_100427302 177
118 3300006051 Ga0075364_10016601 Ga0075364_100166014 177
119 3300006178 Ga0075367_10000034 Ga0075367_100000349 177
120 3300006186 Ga0075369_10000005 Ga0075369_1000000533 177
121 3300006195 Ga0075366_10000083 Ga0075366_1000008322 177
122 3300006237 Ga0097621_100001002 Ga0097621_1000010025 177
123 3300006353 Ga0075370_10031895 Ga0075370_100318955 177
124 3300006358 Ga0068871_100000055 Ga0068871_10000005565 177
125 3300009094 Ga0111539_10030862 Ga0111539_100308628 177
126 3300009098 Ga0105245_10000002 Ga0105245_10000002174 177
127 3300009101 Ga0105247_10361712 Ga0105247_103617122 177
128 3300009148 Ga0105243_10008792 Ga0105243_1000879210 177
129 3300009174 Ga0105241_10000003 Ga0105241_10000003244 177
130 3300009551 Ga0105238_10492207 Ga0105238_104922072 177
131 3300009986 Ga0105033_100127 Ga0105033_1001275 177
132 3300009987 Ga0105030_109053 Ga0105030_1090531 177
133 3300013102 Ga0157371_10000937 Ga0157371_100009376 177
134 3300013105 Ga0157369_10000261 Ga0157369_1000026157 177
135 3300013105 Ga0157369_10438376 Ga0157369_104383762 177
136 3300013296 Ga0157374_10000031 Ga0157374_10000031199 177
137 3300013307 Ga0157372_10763788 Ga0157372_107637882 177
138 3300014326 Ga0157380_10425314 Ga0157380_104253142 177
139 3300025907 Ga0207645_10005159 Ga0207645_100051599 177
140 3300025911 Ga0207654_10000002 Ga0207654_10000002965 177
141 3300025918 Ga0207662_10607528 Ga0207662_106075282 177
142 3300025927 Ga0207687_10000001 Ga0207687_100000011037 177
143 3300025935 Ga0207709_10014139 Ga0207709_100141396 177
144 3300025937 Ga0207669_10009507 Ga0207669_100095072 177
145 3300025945 Ga0207679_10520407 Ga0207679_105204072 177
146 3300025949 Ga0207667_10000008 Ga0207667_1000000857 177
147 3300025949 Ga0207667_10031525 Ga0207667_100315256 177
148 3300025949 Ga0207667_10220052 Ga0207667_102200522 177
149 3300026067 Ga0207678_10279416 Ga0207678_102794161 177
150 3300026116 Ga0207674_10114575 Ga0207674_101145753 177
151 3300027717 Ga0209998_10034733 Ga0209998_100347332 177
152 3300027866 Ga0209813_10025727 Ga0209813_100257272 177
153 3300027907 Ga0207428_10060283 Ga0207428_100602833 177
154 3300028379 Ga0268266_10001150 Ga0268266_1000115018 177
155 3300041460 Ga0451802_0166102 Ga0451802_0166102_71_607 177
156 3300050491 nmdc:mga00v17_3973_c1 nmdc:mga00v17_3973_c1_5721_6254 177
157 3300050493 nmdc:mga0k408_447_c1 nmdc:mga0k408_447_c1_3261_3794 177
158 3300050494 nmdc:mga06z11_2011_c1 nmdc:mga06z11_2011_c1_480_1013 177
159 3300050495 nmdc:mga04h51_26015_c1 nmdc:mga04h51_26015_c1_641_1174 177
160 3300050496 nmdc:mga07m45_346537_c1 nmdc:mga07m45_346537_c1_238_774 177
161 3300050511 nmdc:mga08y16_15042_c1 nmdc:mga08y16_15042_c1_6140_6673 177
162 3300053087 Ga0500643_000038 Ga0500643_000038_50696_51229 177
163 3300053092 Ga0500583_0093446 Ga0500583_0093446_764_1297 177
164 3300053727 Ga0500611_010198 Ga0500611_010198_422_955 177

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00719

Pyrophosphatase

Inorganic pyrophosphatase

20

173

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5tea-assembly1.cif.gz_E crystal structure of an inorganic pyrophosphatase from neisseria gonorrhoeae 0.9893 4 174
5tea-assembly1.cif.gz_E crystal structure of an inorganic pyrophosphatase from neisseria gonorrhoeae 0.9724 4 174
3q46-assembly1.cif.gz_A magnesium activated inorganic pyrophosphatase from thermococcus thioreducens bound to hydrolyzed product at 0.99 angstrom resolution 0.9438 7 176
3q5v-assembly1.cif.gz_A the structure of inorganic pyrophosphatase from thermococcus thioreducens in complex with magnesium and sulfate 0.9422 7 176
1twl-assembly1.cif.gz_A inorganic pyrophosphatase from pyrococcus furiosus pfu-264096-001 0.9395 7 177
ID Description Score Start End Superfamily
5teaF00 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.9895 4 175 3.90.80.10
5teaF00 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.9726 4 175 3.90.80.10
af_A0A1D6HHJ7_152_313_3.90.80.10 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.951 17 176 3.90.80.10
3q5vB00 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.9437 3 175 3.90.80.10
af_A0A0R0EZ04_29_196_3.90.80.10 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.9271 8 169 3.90.80.10
ID Description Score Start End GO Terms
AF-A0A1T0CQR1-F1-model_v4 Inorganic pyrophosphatase (EC 3.6.1.1) (Pyrophosphate phospho-hydrolase) (PPase) 0.9901 1 175 GO:0000287
GO:0004427
GO:0005737
GO:0006796
AF-D4DVF2-F1-model_v4 Inorganic pyrophosphatase (EC 3.6.1.1) (Pyrophosphate phospho-hydrolase) (PPase) 0.9897 1 175 GO:0000287
GO:0004427
GO:0005737
GO:0006796
AF-F0EW23-F1-model_v4 Inorganic pyrophosphatase (EC 3.6.1.1) (Pyrophosphate phospho-hydrolase) (PPase) 0.9895 1 175 GO:0000287
GO:0004427
GO:0005737
GO:0006796
AF-X5EQI0-F1-model_v4 Inorganic pyrophosphatase (EC 3.6.1.1) (Pyrophosphate phospho-hydrolase) (PPase) 0.9885 1 177 GO:0000287
GO:0004427
GO:0005737
GO:0006796
AF-A0A496L5T6-F1-model_v4 deleted 0.9875 1 153

Feature Viewer

pLDDT pTM Quality
93.55 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map