F244654
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 164 | 118 | 164 | 175 |
Family's Representative Sequence
| Representative Sequence | 3300046692|Ga0495671_0451702|Ga0495671_0451702_62_586 |
| Length | 174 |
| Sequence | MADFNQVLTPGDWQSGIVNTVVEITQGSNMKIEWDRERACFMLDRVEPMIFAKPCNYGFIPQTLDEDGDELDTLVVTGPIPTGVYLEAKVIGVLNFIDDGEADHKVVVVPADDRNTGDSINTLDDLGERWKQQIEHHFTHYKDLKKPGSTKVEGWGDVEAAKKIIEESINRYGK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 2 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 21 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 23 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 24 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 25 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 26 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 27 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 28 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 29 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 30 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 31 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 32 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 33 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009986 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG | Metagenome | Rhizosphere |
| 42 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 43 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 72 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 74 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 75 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 76 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 77 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 78 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 79 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 80 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 81 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 82 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 88 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 89 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 90 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 91 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 92 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 93 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 94 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 95 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 96 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 97 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 98 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 99 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 100 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 101 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 102 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 103 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 104 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 105 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 106 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 107 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 108 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 109 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 110 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 111 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 112 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 113 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 114 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 115 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 116 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 117 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 118 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 34.15 |
| Nodule | 0 |
| Rhizoplane | 3.05 |
| Rhizosphere | 60.37 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.44 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1000038 | 3300001915 | Bacteria | 31009 |
| 2 | JGI24742J22300_10000006 | 3300002244 | Bacteria | 41202 |
| 3 | rootH2_10254631 | 3300003320 | Bacteria | 4390 |
| 4 | rootL2_10260349 | 3300003322 | Bacteria | 3447 |
| 5 | rootH1_10344472 | 3300003323 | Bacteria | 1162 |
| 6 | Ga0070658_10235491 | 3300005327 | Unclassified | 1551 |
| 7 | Ga0070676_10000782 | 3300005328 | Bacteria | 15687 |
| 8 | Ga0070690_100024372 | 3300005330 | Unclassified | 3720 |
| 9 | Ga0070670_100627379 | 3300005331 | Unclassified | 963 |
| 10 | Ga0070680_100001276 | 3300005336 | Bacteria | 18211 |
| 11 | Ga0070680_101517393 | 3300005336 | Bacteria | 580 |
| 12 | Ga0070682_100077080 | 3300005337 | Bacteria | 2147 |
| 13 | Ga0070682_100396529 | 3300005337 | Unclassified | 1042 |
| 14 | Ga0070674_100017064 | 3300005356 | Bacteria | 4558 |
| 15 | Ga0070688_100092511 | 3300005365 | Unclassified | 1978 |
| 16 | Ga0070667_101071421 | 3300005367 | Bacteria | 753 |
| 17 | Ga0070681_10013092 | 3300005458 | Bacteria | 8238 |
| 18 | Ga0070681_10149906 | 3300005458 | Bacteria | 2259 |
| 19 | Ga0070681_11201106 | 3300005458 | Bacteria | 680 |
| 20 | Ga0070685_10002053 | 3300005466 | Bacteria | 10422 |
| 21 | Ga0070679_100000730 | 3300005530 | Bacteria | 28399 |
| 22 | Ga0070679_100038365 | 3300005530 | Bacteria | 4762 |
| 23 | Ga0070679_100145652 | 3300005530 | Bacteria | 2347 |
| 24 | Ga0070686_100001746 | 3300005544 | Bacteria | 12170 |
| 25 | Ga0070665_100019550 | 3300005548 | Bacteria | 6799 |
| 26 | Ga0068855_100000003 | 3300005563 | Bacteria | 589862 |
| 27 | Ga0070664_100558014 | 3300005564 | Unclassified | 1059 |
| 28 | Ga0068861_100028631 | 3300005719 | Bacteria | 4066 |
| 29 | Ga0068863_100520715 | 3300005841 | Bacteria | 1172 |
| 30 | Ga0075365_10000958 | 3300006038 | Unclassified | 12253 |
| 31 | Ga0075365_10029697 | 3300006038 | Bacteria | 3497 |
| 32 | Ga0075365_10082475 | 3300006038 | Bacteria | 2180 |
| 33 | Ga0075365_10972638 | 3300006038 | Bacteria | 598 |
| 34 | Ga0075368_10042730 | 3300006042 | Unclassified | 1784 |
| 35 | Ga0075364_10004175 | 3300006051 | Bacteria | 8289 |
| 36 | Ga0075364_10016601 | 3300006051 | Bacteria | 4582 |
| 37 | Ga0075364_10147968 | 3300006051 | Bacteria | 1582 |
| 38 | Ga0075364_10706505 | 3300006051 | Bacteria | 688 |
| 39 | Ga0075367_10000034 | 3300006178 | Bacteria | 29945 |
| 40 | Ga0075367_10341019 | 3300006178 | Unclassified | 945 |
| 41 | Ga0075369_10000005 | 3300006186 | Bacteria | 147699 |
| 42 | Ga0075369_10000051 | 3300006186 | Bacteria | 29832 |
| 43 | Ga0075366_10000001 | 3300006195 | Bacteria | 569172 |
| 44 | Ga0075366_10000044 | 3300006195 | Bacteria | 45021 |
| 45 | Ga0075366_10000083 | 3300006195 | Bacteria | 37001 |
| 46 | Ga0075366_10000342 | 3300006195 | Bacteria | 21427 |
| 47 | Ga0075366_10069694 | 3300006195 | Bacteria | 2093 |
| 48 | Ga0097621_100001002 | 3300006237 | Bacteria | 19854 |
| 49 | Ga0075370_10031895 | 3300006353 | Bacteria | 2943 |
| 50 | Ga0068871_100000055 | 3300006358 | Bacteria | 62753 |
| 51 | Ga0068871_100609681 | 3300006358 | Bacteria | 993 |
| 52 | Ga0105240_10033473 | 3300009093 | Bacteria | 6639 |
| 53 | Ga0111539_10030862 | 3300009094 | Bacteria | 6514 |
| 54 | Ga0105245_10000002 | 3300009098 | Bacteria | 634374 |
| 55 | Ga0105247_10361712 | 3300009101 | Unclassified | 1023 |
| 56 | Ga0105243_10008792 | 3300009148 | Bacteria | 7735 |
| 57 | Ga0105243_10495714 | 3300009148 | Unclassified | 1156 |
| 58 | Ga0105241_10000003 | 3300009174 | Bacteria | 839043 |
| 59 | Ga0105237_10706344 | 3300009545 | Bacteria | 1015 |
| 60 | Ga0105238_10007284 | 3300009551 | Bacteria | 11077 |
| 61 | Ga0105238_10492207 | 3300009551 | Unclassified | 1226 |
| 62 | Ga0105033_100127 | 3300009986 | Bacteria | 5811 |
| 63 | Ga0105030_109053 | 3300009987 | Bacteria | 849 |
| 64 | Ga0157373_10000042 | 3300013100 | Bacteria | 113564 |
| 65 | Ga0157371_10000937 | 3300013102 | Bacteria | 32624 |
| 66 | Ga0157370_10102503 | 3300013104 | Bacteria | 2680 |
| 67 | Ga0157369_10000261 | 3300013105 | Bacteria | 71207 |
| 68 | Ga0157369_10089735 | 3300013105 | Bacteria | 3282 |
| 69 | Ga0157369_10438376 | 3300013105 | Unclassified | 1353 |
| 70 | Ga0157374_10000031 | 3300013296 | Bacteria | 204840 |
| 71 | Ga0157374_10250028 | 3300013296 | Bacteria | 1744 |
| 72 | Ga0157374_12072824 | 3300013296 | Bacteria | 595 |
| 73 | Ga0157372_10000194 | 3300013307 | Bacteria | 66925 |
| 74 | Ga0157372_10763788 | 3300013307 | Bacteria | 1124 |
| 75 | Ga0157380_10425314 | 3300014326 | Bacteria | 1268 |
| 76 | Ga0157377_10048131 | 3300014745 | Bacteria | 2391 |
| 77 | Ga0207645_10005159 | 3300025907 | Bacteria | 9544 |
| 78 | Ga0207705_10186777 | 3300025909 | Unclassified | 1566 |
| 79 | Ga0207654_10000002 | 3300025911 | Bacteria | 1460142 |
| 80 | Ga0207707_10035204 | 3300025912 | Bacteria | 4379 |
| 81 | Ga0207671_10945321 | 3300025914 | Unclassified | 680 |
| 82 | Ga0207660_10020469 | 3300025917 | Bacteria | 4440 |
| 83 | Ga0207662_10607528 | 3300025918 | Bacteria | 761 |
| 84 | Ga0207652_10003903 | 3300025921 | Bacteria | 12193 |
| 85 | Ga0207652_10024398 | 3300025921 | Bacteria | 5017 |
| 86 | Ga0207652_10070130 | 3300025921 | Bacteria | 3043 |
| 87 | Ga0207694_10004584 | 3300025924 | Bacteria | 10769 |
| 88 | Ga0207687_10000001 | 3300025927 | Bacteria | 1130810 |
| 89 | Ga0207644_10086065 | 3300025931 | Unclassified | 2333 |
| 90 | Ga0207709_10014139 | 3300025935 | Bacteria | 4406 |
| 91 | Ga0207709_10365517 | 3300025935 | Unclassified | 1093 |
| 92 | Ga0207669_10009507 | 3300025937 | Bacteria | 4636 |
| 93 | Ga0207679_10520407 | 3300025945 | Unclassified | 1064 |
| 94 | Ga0207667_10000008 | 3300025949 | Bacteria | 625138 |
| 95 | Ga0207667_10031525 | 3300025949 | Bacteria | 5722 |
| 96 | Ga0207667_10220052 | 3300025949 | Bacteria | 1945 |
| 97 | Ga0207678_10279416 | 3300026067 | Bacteria | 1433 |
| 98 | Ga0207641_10033583 | 3300026088 | Bacteria | 4262 |
| 99 | Ga0207674_10114575 | 3300026116 | Bacteria | 2668 |
| 100 | Ga0207674_10138227 | 3300026116 | Bacteria | 2397 |
| 101 | Ga0207674_10509464 | 3300026116 | Bacteria | 1162 |
| 102 | Ga0209998_10034733 | 3300027717 | Unclassified | 1128 |
| 103 | Ga0209813_10025727 | 3300027866 | Bacteria | 1695 |
| 104 | Ga0207428_10060283 | 3300027907 | Unclassified | 3006 |
| 105 | Ga0268266_10001150 | 3300028379 | Bacteria | 32834 |
| 106 | Ga0316179_1091940 | 3300030734 | Unclassified | 2354 |
| 107 | Ga0373935_0491413 | 3300035692 | Bacteria | 890 |
| 108 | Ga0395900_0024461 | 3300037418 | Bacteria | 6185 |
| 109 | Ga0395905_0002005 | 3300037471 | Bacteria | 23268 |
| 110 | Ga0395901_0001919 | 3300038443 | Bacteria | 21405 |
| 111 | Ga0395901_1128696 | 3300038443 | Bacteria | 753 |
| 112 | Ga0451798_0704171 | 3300041458 | Bacteria | 840 |
| 113 | Ga0451802_0166102 | 3300041460 | Unclassified | 1665 |
| 114 | Ga0451833_1262330 | 3300041491 | Unclassified | 1200 |
| 115 | Ga0453683_0624544 | 3300044673 | Bacteria | 703 |
| 116 | Ga0495588_0000116 | 3300046674 | Bacteria | 135919 |
| 117 | Ga0495671_0451702 | 3300046692 | Bacteria | 614 |
| 118 | Ga0495589_0267501 | 3300046794 | Bacteria | 796 |
| 119 | Ga0495676_0201225 | 3300047321 | Bacteria | 1384 |
| 120 | Ga0495686_0376657 | 3300047472 | Bacteria | 766 |
| 121 | Ga0496100_0040985 | 3300048903 | Unclassified | 2949 |
| 122 | Ga0496109_0263775 | 3300048912 | Bacteria | 1623 |
| 123 | Ga0496112_0153491 | 3300048915 | Bacteria | 2270 |
| 124 | Ga0501034_0001444 | 3300049571 | Bacteria | 31518 |
| 125 | Ga0501046_0053953 | 3300049580 | Unclassified | 3164 |
| 126 | Ga0501234_001501 | 3300049707 | Bacteria | 3666 |
| 127 | Ga0501080_0565927 | 3300049742 | Bacteria | 1011 |
| 128 | nmdc:mga00v17_33330_c1 | 3300050491 | Bacteria | 3051 |
| 129 | nmdc:mga00v17_3973_c1 | 3300050491 | Bacteria | 7629 |
| 130 | nmdc:mga00v17_76_c2 | 3300050491 | Bacteria | 52505 |
| 131 | nmdc:mga00v17_815153_c1 | 3300050491 | Bacteria | 594 |
| 132 | nmdc:mga0yw44_1088_c1 | 3300050492 | Bacteria | 10445 |
| 133 | nmdc:mga0yw44_261639_c1 | 3300050492 | Bacteria | 1153 |
| 134 | nmdc:mga0yw44_29003_c1 | 3300050492 | Bacteria | 3190 |
| 135 | nmdc:mga0k408_114_c1 | 3300050493 | Bacteria | 39328 |
| 136 | nmdc:mga0k408_17_c2 | 3300050493 | Bacteria | 97852 |
| 137 | nmdc:mga0k408_1_c1 | 3300050493 | Bacteria | 1089059 |
| 138 | nmdc:mga0k408_447_c1 | 3300050493 | Bacteria | 22558 |
| 139 | nmdc:mga0k408_78298_c2 | 3300050493 | Bacteria | 785 |
| 140 | nmdc:mga06z11_2011_c1 | 3300050494 | Bacteria | 7703 |
| 141 | nmdc:mga04h51_26015_c1 | 3300050495 | Unclassified | 1806 |
| 142 | nmdc:mga07m45_346537_c1 | 3300050496 | Unclassified | 863 |
| 143 | nmdc:mga08y16_15042_c1 | 3300050511 | Bacteria | 8137 |
| 144 | nmdc:mga0sz30_23_c1 | 3300050516 | Bacteria | 65683 |
| 145 | Ga0500643_000038 | 3300053087 | Bacteria | 178974 |
| 146 | Ga0500643_001206 | 3300053087 | Bacteria | 15437 |
| 147 | Ga0500644_0000754 | 3300053088 | Bacteria | 11122 |
| 148 | Ga0500646_0000290 | 3300053090 | Bacteria | 15407 |
| 149 | Ga0500583_0093446 | 3300053092 | Bacteria | 1466 |
| 150 | Ga0500651_0173560 | 3300053093 | Bacteria | 1284 |
| 151 | Ga0500650_0000001 | 3300053098 | Bacteria | 818797 |
| 152 | Ga0500556_0002083 | 3300053104 | Bacteria | 6890 |
| 153 | Ga0500562_024986 | 3300053108 | Bacteria | 1562 |
| 154 | Ga0500594_0000001 | 3300053118 | Bacteria | 1178472 |
| 155 | Ga0500614_000001 | 3300053123 | Bacteria | 1274484 |
| 156 | Ga0500655_000436 | 3300053133 | Bacteria | 8576 |
| 157 | Ga0500577_0001431 | 3300053142 | Bacteria | 6111 |
| 158 | Ga0500577_0003251 | 3300053142 | Bacteria | 4209 |
| 159 | Ga0500579_005844 | 3300053143 | Bacteria | 7590 |
| 160 | Ga0500649_000013 | 3300053722 | Bacteria | 73694 |
| 161 | Ga0500570_008025 | 3300053724 | Bacteria | 5814 |
| 162 | Ga0500611_000230 | 3300053727 | Bacteria | 6454 |
| 163 | Ga0500611_010198 | 3300053727 | Bacteria | 1515 |
| 164 | Ga0500599_026868 | 3300053736 | Unclassified | 841 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046794 | Ga0495589_0267501 | Ga0495589_0267501_27_479 | 149 |
| 2 | 3300044673 | Ga0453683_0624544 | Ga0453683_0624544_226_693 | 155 |
| 3 | 3300006186 | Ga0075369_10000051 | Ga0075369_1000005111 | 158 |
| 4 | 3300006195 | Ga0075366_10000001 | Ga0075366_10000001472 | 158 |
| 5 | 3300046674 | Ga0495588_0000116 | Ga0495588_0000116_120141_120677 | 158 |
| 6 | 3300047321 | Ga0495676_0201225 | Ga0495676_0201225_769_1305 | 158 |
| 7 | 3300050493 | nmdc:mga0k408_1_c1 | nmdc:mga0k408_1_c1_643325_643855 | 158 |
| 8 | 3300050516 | nmdc:mga0sz30_23_c1 | nmdc:mga0sz30_23_c1_49475_50005 | 158 |
| 9 | 3300053123 | Ga0500614_000001 | Ga0500614_000001_318672_319208 | 158 |
| 10 | 3300053722 | Ga0500649_000013 | Ga0500649_000013_66751_67287 | 158 |
| 11 | 3300041458 | Ga0451798_0704171 | Ga0451798_0704171_341_823 | 160 |
| 12 | 3300050491 | nmdc:mga00v17_815153_c1 | nmdc:mga00v17_815153_c1_71_583 | 170 |
| 13 | 3300026116 | Ga0207674_10509464 | Ga0207674_105094642 | 171 |
| 14 | 3300003320 | rootH2_10254631 | rootH2_102546313 | 174 |
| 15 | 3300005331 | Ga0070670_100627379 | Ga0070670_1006273792 | 174 |
| 16 | 3300046692 | Ga0495671_0451702 | Ga0495671_0451702_62_586 | 174 |
| 17 | 3300053088 | Ga0500644_0000754 | Ga0500644_0000754_4389_4913 | 174 |
| 18 | 3300053142 | Ga0500577_0001431 | Ga0500577_0001431_4284_4808 | 174 |
| 19 | 3300053727 | Ga0500611_000230 | Ga0500611_000230_1104_1628 | 174 |
| 20 | 3300005458 | Ga0070681_10013092 | Ga0070681_1001309210 | 175 |
| 21 | 3300006195 | Ga0075366_10069694 | Ga0075366_100696942 | 175 |
| 22 | 3300006358 | Ga0068871_100609681 | Ga0068871_1006096811 | 175 |
| 23 | 3300013296 | Ga0157374_10250028 | Ga0157374_102500282 | 175 |
| 24 | 3300025912 | Ga0207707_10035204 | Ga0207707_100352044 | 175 |
| 25 | 3300035692 | Ga0373935_0491413 | Ga0373935_0491413_327_854 | 175 |
| 26 | 3300037471 | Ga0395905_0002005 | Ga0395905_0002005_4849_5376 | 175 |
| 27 | 3300038443 | Ga0395901_0001919 | Ga0395901_0001919_10314_10841 | 175 |
| 28 | 3300038443 | Ga0395901_1128696 | Ga0395901_1128696_77_604 | 175 |
| 29 | 3300041491 | Ga0451833_1262330 | Ga0451833_1262330_276_803 | 175 |
| 30 | 3300048903 | Ga0496100_0040985 | Ga0496100_0040985_190_717 | 175 |
| 31 | 3300050493 | nmdc:mga0k408_78298_c2 | nmdc:mga0k408_78298_c2_91_618 | 175 |
| 32 | 3300053087 | Ga0500643_001206 | Ga0500643_001206_9746_10273 | 175 |
| 33 | 3300053724 | Ga0500570_008025 | Ga0500570_008025_3805_4332 | 175 |
| 34 | 3300003322 | rootL2_10260349 | rootL2_102603493 | 176 |
| 35 | 3300003323 | rootH1_10344472 | rootH1_103444721 | 176 |
| 36 | 3300005327 | Ga0070658_10235491 | Ga0070658_102354912 | 176 |
| 37 | 3300005330 | Ga0070690_100024372 | Ga0070690_1000243722 | 176 |
| 38 | 3300005336 | Ga0070680_100001276 | Ga0070680_1000012766 | 176 |
| 39 | 3300005336 | Ga0070680_101517393 | Ga0070680_1015173931 | 176 |
| 40 | 3300005367 | Ga0070667_101071421 | Ga0070667_1010714212 | 176 |
| 41 | 3300005458 | Ga0070681_10149906 | Ga0070681_101499063 | 176 |
| 42 | 3300005458 | Ga0070681_11201106 | Ga0070681_112011061 | 176 |
| 43 | 3300005530 | Ga0070679_100000730 | Ga0070679_10000073013 | 176 |
| 44 | 3300005530 | Ga0070679_100038365 | Ga0070679_1000383654 | 176 |
| 45 | 3300005530 | Ga0070679_100145652 | Ga0070679_1001456522 | 176 |
| 46 | 3300005544 | Ga0070686_100001746 | Ga0070686_10000174613 | 176 |
| 47 | 3300005841 | Ga0068863_100520715 | Ga0068863_1005207152 | 176 |
| 48 | 3300006038 | Ga0075365_10000958 | Ga0075365_100009582 | 176 |
| 49 | 3300006038 | Ga0075365_10029697 | Ga0075365_100296972 | 176 |
| 50 | 3300006038 | Ga0075365_10972638 | Ga0075365_109726381 | 176 |
| 51 | 3300006051 | Ga0075364_10004175 | Ga0075364_100041758 | 176 |
| 52 | 3300006051 | Ga0075364_10147968 | Ga0075364_101479682 | 176 |
| 53 | 3300006051 | Ga0075364_10706505 | Ga0075364_107065051 | 176 |
| 54 | 3300006178 | Ga0075367_10341019 | Ga0075367_103410192 | 176 |
| 55 | 3300006195 | Ga0075366_10000044 | Ga0075366_1000004443 | 176 |
| 56 | 3300006195 | Ga0075366_10000342 | Ga0075366_1000034210 | 176 |
| 57 | 3300009093 | Ga0105240_10033473 | Ga0105240_100334732 | 176 |
| 58 | 3300009148 | Ga0105243_10495714 | Ga0105243_104957141 | 176 |
| 59 | 3300009545 | Ga0105237_10706344 | Ga0105237_107063441 | 176 |
| 60 | 3300009551 | Ga0105238_10007284 | Ga0105238_100072842 | 176 |
| 61 | 3300013100 | Ga0157373_10000042 | Ga0157373_100000428 | 176 |
| 62 | 3300013104 | Ga0157370_10102503 | Ga0157370_101025032 | 176 |
| 63 | 3300013105 | Ga0157369_10089735 | Ga0157369_100897354 | 176 |
| 64 | 3300013296 | Ga0157374_12072824 | Ga0157374_120728241 | 176 |
| 65 | 3300013307 | Ga0157372_10000194 | Ga0157372_1000019465 | 176 |
| 66 | 3300014745 | Ga0157377_10048131 | Ga0157377_100481312 | 176 |
| 67 | 3300025909 | Ga0207705_10186777 | Ga0207705_101867772 | 176 |
| 68 | 3300025914 | Ga0207671_10945321 | Ga0207671_109453212 | 176 |
| 69 | 3300025917 | Ga0207660_10020469 | Ga0207660_100204692 | 176 |
| 70 | 3300025921 | Ga0207652_10003903 | Ga0207652_1000390314 | 176 |
| 71 | 3300025921 | Ga0207652_10024398 | Ga0207652_100243987 | 176 |
| 72 | 3300025921 | Ga0207652_10070130 | Ga0207652_100701304 | 176 |
| 73 | 3300025924 | Ga0207694_10004584 | Ga0207694_100045842 | 176 |
| 74 | 3300025931 | Ga0207644_10086065 | Ga0207644_100860653 | 176 |
| 75 | 3300025935 | Ga0207709_10365517 | Ga0207709_103655172 | 176 |
| 76 | 3300026088 | Ga0207641_10033583 | Ga0207641_100335835 | 176 |
| 77 | 3300026116 | Ga0207674_10138227 | Ga0207674_101382272 | 176 |
| 78 | 3300030734 | Ga0316179_1091940 | Ga0316179_10919402 | 176 |
| 79 | 3300037418 | Ga0395900_0024461 | Ga0395900_0024461_415_978 | 176 |
| 80 | 3300047472 | Ga0495686_0376657 | Ga0495686_0376657_129_659 | 176 |
| 81 | 3300048912 | Ga0496109_0263775 | Ga0496109_0263775_136_666 | 176 |
| 82 | 3300048915 | Ga0496112_0153491 | Ga0496112_0153491_1517_2047 | 176 |
| 83 | 3300049571 | Ga0501034_0001444 | Ga0501034_0001444_23991_24521 | 176 |
| 84 | 3300049580 | Ga0501046_0053953 | Ga0501046_0053953_1878_2408 | 176 |
| 85 | 3300049707 | Ga0501234_001501 | Ga0501234_001501_813_1343 | 176 |
| 86 | 3300049742 | Ga0501080_0565927 | Ga0501080_0565927_146_676 | 176 |
| 87 | 3300050491 | nmdc:mga00v17_33330_c1 | nmdc:mga00v17_33330_c1_1892_2422 | 176 |
| 88 | 3300050491 | nmdc:mga00v17_76_c2 | nmdc:mga00v17_76_c2_23311_23841 | 176 |
| 89 | 3300050492 | nmdc:mga0yw44_1088_c1 | nmdc:mga0yw44_1088_c1_81_611 | 176 |
| 90 | 3300050492 | nmdc:mga0yw44_261639_c1 | nmdc:mga0yw44_261639_c1_48_578 | 176 |
| 91 | 3300050492 | nmdc:mga0yw44_29003_c1 | nmdc:mga0yw44_29003_c1_339_869 | 176 |
| 92 | 3300050493 | nmdc:mga0k408_114_c1 | nmdc:mga0k408_114_c1_11758_12288 | 176 |
| 93 | 3300050493 | nmdc:mga0k408_17_c2 | nmdc:mga0k408_17_c2_10644_11174 | 176 |
| 94 | 3300053090 | Ga0500646_0000290 | Ga0500646_0000290_10130_10660 | 176 |
| 95 | 3300053093 | Ga0500651_0173560 | Ga0500651_0173560_43_573 | 176 |
| 96 | 3300053098 | Ga0500650_0000001 | Ga0500650_0000001_403785_404315 | 176 |
| 97 | 3300053104 | Ga0500556_0002083 | Ga0500556_0002083_5294_5827 | 176 |
| 98 | 3300053108 | Ga0500562_024986 | Ga0500562_024986_841_1371 | 176 |
| 99 | 3300053118 | Ga0500594_0000001 | Ga0500594_0000001_1064863_1065393 | 176 |
| 100 | 3300053133 | Ga0500655_000436 | Ga0500655_000436_2797_3327 | 176 |
| 101 | 3300053142 | Ga0500577_0003251 | Ga0500577_0003251_3550_4080 | 176 |
| 102 | 3300053143 | Ga0500579_005844 | Ga0500579_005844_6735_7265 | 176 |
| 103 | 3300053736 | Ga0500599_026868 | Ga0500599_026868_89_619 | 176 |
| 104 | 3300001915 | JGI24741J21665_1000038 | JGI24741J21665_100003822 | 177 |
| 105 | 3300002244 | JGI24742J22300_10000006 | JGI24742J22300_1000000617 | 177 |
| 106 | 3300005328 | Ga0070676_10000782 | Ga0070676_1000078216 | 177 |
| 107 | 3300005337 | Ga0070682_100077080 | Ga0070682_1000770801 | 177 |
| 108 | 3300005337 | Ga0070682_100396529 | Ga0070682_1003965291 | 177 |
| 109 | 3300005356 | Ga0070674_100017064 | Ga0070674_1000170643 | 177 |
| 110 | 3300005365 | Ga0070688_100092511 | Ga0070688_1000925113 | 177 |
| 111 | 3300005466 | Ga0070685_10002053 | Ga0070685_100020533 | 177 |
| 112 | 3300005548 | Ga0070665_100019550 | Ga0070665_1000195509 | 177 |
| 113 | 3300005563 | Ga0068855_100000003 | Ga0068855_10000000358 | 177 |
| 114 | 3300005564 | Ga0070664_100558014 | Ga0070664_1005580141 | 177 |
| 115 | 3300005719 | Ga0068861_100028631 | Ga0068861_1000286312 | 177 |
| 116 | 3300006038 | Ga0075365_10082475 | Ga0075365_100824752 | 177 |
| 117 | 3300006042 | Ga0075368_10042730 | Ga0075368_100427302 | 177 |
| 118 | 3300006051 | Ga0075364_10016601 | Ga0075364_100166014 | 177 |
| 119 | 3300006178 | Ga0075367_10000034 | Ga0075367_100000349 | 177 |
| 120 | 3300006186 | Ga0075369_10000005 | Ga0075369_1000000533 | 177 |
| 121 | 3300006195 | Ga0075366_10000083 | Ga0075366_1000008322 | 177 |
| 122 | 3300006237 | Ga0097621_100001002 | Ga0097621_1000010025 | 177 |
| 123 | 3300006353 | Ga0075370_10031895 | Ga0075370_100318955 | 177 |
| 124 | 3300006358 | Ga0068871_100000055 | Ga0068871_10000005565 | 177 |
| 125 | 3300009094 | Ga0111539_10030862 | Ga0111539_100308628 | 177 |
| 126 | 3300009098 | Ga0105245_10000002 | Ga0105245_10000002174 | 177 |
| 127 | 3300009101 | Ga0105247_10361712 | Ga0105247_103617122 | 177 |
| 128 | 3300009148 | Ga0105243_10008792 | Ga0105243_1000879210 | 177 |
| 129 | 3300009174 | Ga0105241_10000003 | Ga0105241_10000003244 | 177 |
| 130 | 3300009551 | Ga0105238_10492207 | Ga0105238_104922072 | 177 |
| 131 | 3300009986 | Ga0105033_100127 | Ga0105033_1001275 | 177 |
| 132 | 3300009987 | Ga0105030_109053 | Ga0105030_1090531 | 177 |
| 133 | 3300013102 | Ga0157371_10000937 | Ga0157371_100009376 | 177 |
| 134 | 3300013105 | Ga0157369_10000261 | Ga0157369_1000026157 | 177 |
| 135 | 3300013105 | Ga0157369_10438376 | Ga0157369_104383762 | 177 |
| 136 | 3300013296 | Ga0157374_10000031 | Ga0157374_10000031199 | 177 |
| 137 | 3300013307 | Ga0157372_10763788 | Ga0157372_107637882 | 177 |
| 138 | 3300014326 | Ga0157380_10425314 | Ga0157380_104253142 | 177 |
| 139 | 3300025907 | Ga0207645_10005159 | Ga0207645_100051599 | 177 |
| 140 | 3300025911 | Ga0207654_10000002 | Ga0207654_10000002965 | 177 |
| 141 | 3300025918 | Ga0207662_10607528 | Ga0207662_106075282 | 177 |
| 142 | 3300025927 | Ga0207687_10000001 | Ga0207687_100000011037 | 177 |
| 143 | 3300025935 | Ga0207709_10014139 | Ga0207709_100141396 | 177 |
| 144 | 3300025937 | Ga0207669_10009507 | Ga0207669_100095072 | 177 |
| 145 | 3300025945 | Ga0207679_10520407 | Ga0207679_105204072 | 177 |
| 146 | 3300025949 | Ga0207667_10000008 | Ga0207667_1000000857 | 177 |
| 147 | 3300025949 | Ga0207667_10031525 | Ga0207667_100315256 | 177 |
| 148 | 3300025949 | Ga0207667_10220052 | Ga0207667_102200522 | 177 |
| 149 | 3300026067 | Ga0207678_10279416 | Ga0207678_102794161 | 177 |
| 150 | 3300026116 | Ga0207674_10114575 | Ga0207674_101145753 | 177 |
| 151 | 3300027717 | Ga0209998_10034733 | Ga0209998_100347332 | 177 |
| 152 | 3300027866 | Ga0209813_10025727 | Ga0209813_100257272 | 177 |
| 153 | 3300027907 | Ga0207428_10060283 | Ga0207428_100602833 | 177 |
| 154 | 3300028379 | Ga0268266_10001150 | Ga0268266_1000115018 | 177 |
| 155 | 3300041460 | Ga0451802_0166102 | Ga0451802_0166102_71_607 | 177 |
| 156 | 3300050491 | nmdc:mga00v17_3973_c1 | nmdc:mga00v17_3973_c1_5721_6254 | 177 |
| 157 | 3300050493 | nmdc:mga0k408_447_c1 | nmdc:mga0k408_447_c1_3261_3794 | 177 |
| 158 | 3300050494 | nmdc:mga06z11_2011_c1 | nmdc:mga06z11_2011_c1_480_1013 | 177 |
| 159 | 3300050495 | nmdc:mga04h51_26015_c1 | nmdc:mga04h51_26015_c1_641_1174 | 177 |
| 160 | 3300050496 | nmdc:mga07m45_346537_c1 | nmdc:mga07m45_346537_c1_238_774 | 177 |
| 161 | 3300050511 | nmdc:mga08y16_15042_c1 | nmdc:mga08y16_15042_c1_6140_6673 | 177 |
| 162 | 3300053087 | Ga0500643_000038 | Ga0500643_000038_50696_51229 | 177 |
| 163 | 3300053092 | Ga0500583_0093446 | Ga0500583_0093446_764_1297 | 177 |
| 164 | 3300053727 | Ga0500611_010198 | Ga0500611_010198_422_955 | 177 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5tea-assembly1.cif.gz_E | crystal structure of an inorganic pyrophosphatase from neisseria gonorrhoeae | 0.9893 | 4 | 174 |
| 5tea-assembly1.cif.gz_E | crystal structure of an inorganic pyrophosphatase from neisseria gonorrhoeae | 0.9724 | 4 | 174 |
| 3q46-assembly1.cif.gz_A | magnesium activated inorganic pyrophosphatase from thermococcus thioreducens bound to hydrolyzed product at 0.99 angstrom resolution | 0.9438 | 7 | 176 |
| 3q5v-assembly1.cif.gz_A | the structure of inorganic pyrophosphatase from thermococcus thioreducens in complex with magnesium and sulfate | 0.9422 | 7 | 176 |
| 1twl-assembly1.cif.gz_A | inorganic pyrophosphatase from pyrococcus furiosus pfu-264096-001 | 0.9395 | 7 | 177 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5teaF00 | Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase | 0.9895 | 4 | 175 | 3.90.80.10 |
| 5teaF00 | Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase | 0.9726 | 4 | 175 | 3.90.80.10 |
| af_A0A1D6HHJ7_152_313_3.90.80.10 | Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase | 0.951 | 17 | 176 | 3.90.80.10 |
| 3q5vB00 | Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase | 0.9437 | 3 | 175 | 3.90.80.10 |
| af_A0A0R0EZ04_29_196_3.90.80.10 | Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase | 0.9271 | 8 | 169 | 3.90.80.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1T0CQR1-F1-model_v4 | Inorganic pyrophosphatase (EC 3.6.1.1) (Pyrophosphate phospho-hydrolase) (PPase) | 0.9901 | 1 | 175 |
GO:0000287
GO:0004427 GO:0005737 GO:0006796 |
| AF-D4DVF2-F1-model_v4 | Inorganic pyrophosphatase (EC 3.6.1.1) (Pyrophosphate phospho-hydrolase) (PPase) | 0.9897 | 1 | 175 |
GO:0000287
GO:0004427 GO:0005737 GO:0006796 |
| AF-F0EW23-F1-model_v4 | Inorganic pyrophosphatase (EC 3.6.1.1) (Pyrophosphate phospho-hydrolase) (PPase) | 0.9895 | 1 | 175 |
GO:0000287
GO:0004427 GO:0005737 GO:0006796 |
| AF-X5EQI0-F1-model_v4 | Inorganic pyrophosphatase (EC 3.6.1.1) (Pyrophosphate phospho-hydrolase) (PPase) | 0.9885 | 1 | 177 |
GO:0000287
GO:0004427 GO:0005737 GO:0006796 |
| AF-A0A496L5T6-F1-model_v4 | deleted | 0.9875 | 1 | 153 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar