F244372

General Info

Members Datasets Scaffolds Average Seq Length
164 92 328 124

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_1270272|Ga0436364_1270272_622_1029
Length 135
Sequence MAETTEPNFEFPVPPASLAFLVESILMQTQIQLGLLDLGDKDDKEPEPNLPLARHSIDMLGMLQDKTRGNLTVEEQRLIENGLTELRFRYVQVADEMKKRSEPAPTITTPGAAATPADDGPRIITADGGKGTKTG

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
21 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
25 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
26 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
27 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
28 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
29 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
30 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
31 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
32 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
35 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
36 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
37 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
38 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
39 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
40 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
41 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
42 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
60 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
61 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
62 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
63 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
64 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
65 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
66 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
67 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
68 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
69 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
70 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
71 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
72 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
73 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
74 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
75 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
76 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
77 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
78 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
79 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
80 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
81 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
82 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
87 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
88 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
90 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
91 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
92 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.78
Metatranscriptomes 1.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.44
Rhizosphere 75
Stem 0
Stem Tuber 0
Unclassified 39.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_1270272 3300037853 Unclassified 1673
2 Ga0058861_11978670 3300004800 Unclassified 641
3 Ga0070683_100130144 3300005329 Bacteria 2382
4 Ga0070683_101254473 3300005329 Bacteria 712
5 Ga0070680_100105155 3300005336 Bacteria 2346
6 Ga0070682_101450032 3300005337 Unclassified 588
7 Ga0070660_100112628 3300005339 Bacteria 2166
8 Ga0070660_100579709 3300005339 Unclassified 937
9 Ga0070692_10085577 3300005345 Unclassified 1706
10 Ga0070659_100002670 3300005366 Bacteria 12685
11 Ga0070659_101353130 3300005366 Unclassified 632
12 Ga0070714_101223280 3300005435 Unclassified 733
13 Ga0070713_100358633 3300005436 Bacteria 1354
14 Ga0070713_100699349 3300005436 Unclassified 968
15 Ga0070663_100021622 3300005455 Bacteria 4283
16 Ga0070707_101106780 3300005468 Bacteria 758
17 Ga0070679_100070264 3300005530 Bacteria 3493
18 Ga0070679_100235993 3300005530 Bacteria 1788
19 Ga0070679_100350337 3300005530 Unclassified 1424
20 Ga0070679_100889831 3300005530 Bacteria 834
21 Ga0070684_100153452 3300005535 Bacteria 2087
22 Ga0070684_100880858 3300005535 Unclassified 838
23 Ga0070665_100081185 3300005548 Bacteria 3248
24 Ga0070665_100617293 3300005548 Unclassified 1097
25 Ga0068855_100011443 3300005563 Bacteria 10718
26 Ga0068855_100583583 3300005563 Unclassified 1207
27 Ga0068855_100852190 3300005563 Unclassified 965
28 Ga0070664_100289950 3300005564 Bacteria 1477
29 Ga0068856_100003593 3300005614 Bacteria 15605
30 Ga0068856_100074296 3300005614 Bacteria 3365
31 Ga0068856_100528130 3300005614 Unclassified 1201
32 Ga0070717_10054638 3300006028 Bacteria 3294
33 Ga0070712_100370292 3300006175 Bacteria 1177
34 Ga0097621_100290106 3300006237 Unclassified 1442
35 Ga0068871_100817353 3300006358 Bacteria 860
36 Ga0105240_11663465 3300009093 Unclassified 667
37 Ga0105241_10933320 3300009174 Unclassified 808
38 Ga0105237_10647657 3300009545 Unclassified 1063
39 Ga0105237_12173151 3300009545 Unclassified 564
40 Ga0157373_10096477 3300013100 Bacteria 2081
41 Ga0157371_10069373 3300013102 Unclassified 2496
42 Ga0157370_10012766 3300013104 Bacteria 8688
43 Ga0157370_10022283 3300013104 Bacteria 6305
44 Ga0157370_10137616 3300013104 Bacteria 2275
45 Ga0157369_10004768 3300013105 Bacteria 15943
46 Ga0157369_10066985 3300013105 Unclassified 3862
47 Ga0157369_10099166 3300013105 Bacteria 3106
48 Ga0157374_10013633 3300013296 Bacteria 7100
49 Ga0157374_10024660 3300013296 Bacteria 5393
50 Ga0157378_12741886 3300013297 Unclassified 545
51 Ga0163162_10840347 3300013306 Bacteria 1034
52 Ga0157372_10162964 3300013307 Unclassified 2577
53 Ga0157372_10275100 3300013307 Bacteria 1957
54 Ga0157372_10498330 3300013307 Unclassified 1420
55 Ga0157376_10458141 3300014969 Unclassified 1245
56 Ga0182006_1217897 3300015261 Unclassified 630
57 Ga0213873_10022915 3300021358 Bacteria 1484
58 Ga0213873_10093441 3300021358 Bacteria 857
59 Ga0213872_10000725 3300021361 Bacteria 24616
60 Ga0213872_10231442 3300021361 Unclassified 784
61 Ga0213874_10014480 3300021377 Bacteria 2063
62 Ga0213876_10044184 3300021384 Bacteria 2355
63 Ga0213875_10007428 3300021388 Bacteria 5661
64 Ga0213875_10020963 3300021388 Unclassified 3133
65 Ga0213875_10079220 3300021388 Bacteria 1532
66 Ga0213875_10196866 3300021388 Archaea 948
67 Ga0213875_10243812 3300021388 Bacteria 847
68 Ga0213871_10002484 3300021441 Bacteria 3392
69 Ga0224712_10018652 3300022467 Bacteria 2324
70 Ga0207671_10521497 3300025914 Unclassified 947
71 Ga0207693_10678169 3300025915 Unclassified 799
72 Ga0207660_10112064 3300025917 Bacteria 2054
73 Ga0207657_10059685 3300025919 Bacteria 3275
74 Ga0207652_10181711 3300025921 Bacteria 1890
75 Ga0207652_10245993 3300025921 Bacteria 1613
76 Ga0207700_10522833 3300025928 Bacteria 1051
77 Ga0207700_11144904 3300025928 Unclassified 695
78 Ga0207664_10070394 3300025929 Bacteria 2815
79 Ga0207690_10013752 3300025932 Bacteria 4872
80 Ga0207661_10651314 3300025944 Bacteria 968
81 Ga0207661_12013061 3300025944 Unclassified 523
82 Ga0207679_10266223 3300025945 Bacteria 1464
83 Ga0207667_10003293 3300025949 Bacteria 19935
84 Ga0207667_10831217 3300025949 Unclassified 919
85 Ga0207678_10013704 3300026067 Bacteria 7122
86 Ga0207678_10984967 3300026067 Unclassified 746
87 Ga0207702_10016749 3300026078 Bacteria 6067
88 Ga0207674_10397405 3300026116 Bacteria 1332
89 Ga0207683_10613172 3300026121 Bacteria 1007
90 Ga0268266_10007621 3300028379 Bacteria 9742
91 Ga0268266_10450062 3300028379 Unclassified 1224
92 Ga0373923_0059892 3300035111 Unclassified 1615
93 Ga0373936_0099247 3300035113 Unclassified 1227
94 Ga0373954_0141743 3300035118 Unclassified 1172
95 Ga0373943_0437721 3300035170 Unclassified 758
96 Ga0373935_0045091 3300035692 Bacteria 2781
97 Ga0373935_1499206 3300035692 Unclassified 505
98 Ga0373933_0094611 3300035724 Unclassified 1848
99 Ga0373947_0039462 3300035725 Unclassified 2809
100 Ga0373925_0039443 3300037068 Unclassified 3494
101 Ga0395900_0967794 3300037418 Bacteria 772
102 Ga0436364_0106688 3300037853 Bacteria 6850
103 Ga0436364_0108665 3300037853 Unclassified 621
104 Ga0436364_0156367 3300037853 Bacteria 665
105 Ga0436364_0307361 3300037853 Bacteria 1812
106 Ga0436364_0419418 3300037853 Bacteria 7324
107 Ga0436364_0434995 3300037853 Unclassified 2224
108 Ga0436364_0607776 3300037853 Bacteria 6510
109 Ga0436364_0642948 3300037853 Unclassified 1341
110 Ga0436364_0944751 3300037853 Bacteria 18572
111 Ga0436364_1068168 3300037853 Unclassified 516
112 Ga0436364_1073325 3300037853 Unclassified 647
113 Ga0436364_1111350 3300037853 Bacteria 1357
114 Ga0436364_1201710 3300037853 Bacteria 1549
115 Ga0436364_1416805 3300037853 Archaea 1505
116 Ga0436364_1417422 3300037853 Unclassified 1193
117 Ga0436365_0504905 3300039437 Unclassified 1729
118 Ga0436365_0610776 3300039437 Unclassified 784
119 Ga0436365_0666440 3300039437 Bacteria 2535
120 Ga0436365_0752961 3300039437 Bacteria 938
121 Ga0436365_0879280 3300039437 Unclassified 649
122 Ga0436365_0883864 3300039437 Bacteria 5180
123 Ga0436365_1135140 3300039437 Bacteria 2796
124 Ga0436365_1339549 3300039437 Bacteria 1204
125 Ga0436360_1204046 3300039438 Bacteria 6376
126 Ga0436361_0538573 3300039447 Bacteria 985
127 Ga0436361_0815288 3300039447 Bacteria 63464
128 Ga0436363_0379772 3300039450 Bacteria 1510
129 Ga0436363_0512378 3300039450 Bacteria 572
130 Ga0436363_0701529 3300039450 Unclassified 675
131 Ga0436363_0797115 3300039450 Unclassified 531
132 Ga0436363_1036278 3300039450 Bacteria 6402
133 Ga0436362_0092264 3300039453 Bacteria 1657
134 Ga0436362_0105512 3300039453 Bacteria 2562
135 Ga0436362_0108738 3300039453 Unclassified 1099
136 Ga0436362_0121883 3300039453 Bacteria 1168
137 Ga0436362_0389092 3300039453 Bacteria 868
138 Ga0466966_0056416 3300044684 Bacteria 2485
139 Ga0466959_0460398 3300045049 Unclassified 862
140 Ga0466958_0181781 3300045836 Bacteria 1335
141 Ga0466958_0976432 3300045836 Unclassified 553
142 Ga0466967_0197480 3300045976 Bacteria 1904
143 Ga0466967_0799090 3300045976 Bacteria 937
144 Ga0466967_1047237 3300045976 Unclassified 813
145 Ga0495580_0072943 3300046472 Bacteria 2397
146 Ga0496109_0644944 3300048912 Bacteria 996
147 Ga0496109_1354373 3300048912 Unclassified 647
148 Ga0496112_0014093 3300048915 Bacteria 7402
149 Ga0496115_0033032 3300048918 Bacteria 4084
150 Ga0496126_1081644 3300048929 Unclassified 597
151 Ga0501037_0116373 3300049573 Bacteria 1924
152 Ga0501043_0593384 3300049579 Unclassified 819
153 Ga0501046_1217504 3300049580 Unclassified 517
154 Ga0501047_0060795 3300049581 Bacteria 3645
155 Ga0501047_0068933 3300049581 Bacteria 3407
156 Ga0501074_0673826 3300049590 Bacteria 730
157 Ga0501080_0397755 3300049742 Unclassified 1240
158 Ga0501035_0173772 3300049822 Bacteria 1860
159 Ga0501044_0000499 3300049823 Bacteria 47706
160 Ga0501044_0002734 3300049823 Bacteria 20061
161 Ga0501044_0132013 3300049823 Bacteria 2491
162 Ga0495601_0101363 3300053077 Unclassified 1860
163 Ga0501084_0679160 3300054114 Bacteria 869
164 Ga0501082_1378336 3300060353 Unclassified 616
165 Ga0436364_1270272
166 Ga0058861_11978670
167 Ga0070683_100130144
168 Ga0070683_101254473
169 Ga0070680_100105155
170 Ga0070682_101450032
171 Ga0070660_100112628
172 Ga0070660_100579709
173 Ga0070692_10085577
174 Ga0070659_100002670
175 Ga0070659_101353130
176 Ga0070714_101223280
177 Ga0070713_100358633
178 Ga0070713_100699349
179 Ga0070663_100021622
180 Ga0070707_101106780
181 Ga0070679_100070264
182 Ga0070679_100235993
183 Ga0070679_100350337
184 Ga0070679_100889831
185 Ga0070684_100153452
186 Ga0070684_100880858
187 Ga0070665_100081185
188 Ga0070665_100617293
189 Ga0068855_100011443
190 Ga0068855_100583583
191 Ga0068855_100852190
192 Ga0070664_100289950
193 Ga0068856_100003593
194 Ga0068856_100074296
195 Ga0068856_100528130
196 Ga0070717_10054638
197 Ga0070712_100370292
198 Ga0097621_100290106
199 Ga0068871_100817353
200 Ga0105240_11663465
201 Ga0105241_10933320
202 Ga0105237_10647657
203 Ga0105237_12173151
204 Ga0157373_10096477
205 Ga0157371_10069373
206 Ga0157370_10012766
207 Ga0157370_10022283
208 Ga0157370_10137616
209 Ga0157369_10004768
210 Ga0157369_10066985
211 Ga0157369_10099166
212 Ga0157374_10013633
213 Ga0157374_10024660
214 Ga0157378_12741886
215 Ga0163162_10840347
216 Ga0157372_10162964
217 Ga0157372_10275100
218 Ga0157372_10498330
219 Ga0157376_10458141
220 Ga0182006_1217897
221 Ga0213873_10022915
222 Ga0213873_10093441
223 Ga0213872_10000725
224 Ga0213872_10231442
225 Ga0213874_10014480
226 Ga0213876_10044184
227 Ga0213875_10007428
228 Ga0213875_10020963
229 Ga0213875_10079220
230 Ga0213875_10196866
231 Ga0213875_10243812
232 Ga0213871_10002484
233 Ga0224712_10018652
234 Ga0207671_10521497
235 Ga0207693_10678169
236 Ga0207660_10112064
237 Ga0207657_10059685
238 Ga0207652_10181711
239 Ga0207652_10245993
240 Ga0207700_10522833
241 Ga0207700_11144904
242 Ga0207664_10070394
243 Ga0207690_10013752
244 Ga0207661_10651314
245 Ga0207661_12013061
246 Ga0207679_10266223
247 Ga0207667_10003293
248 Ga0207667_10831217
249 Ga0207678_10013704
250 Ga0207678_10984967
251 Ga0207702_10016749
252 Ga0207674_10397405
253 Ga0207683_10613172
254 Ga0268266_10007621
255 Ga0268266_10450062
256 Ga0373923_0059892
257 Ga0373936_0099247
258 Ga0373954_0141743
259 Ga0373943_0437721
260 Ga0373935_0045091
261 Ga0373935_1499206
262 Ga0373933_0094611
263 Ga0373947_0039462
264 Ga0373925_0039443
265 Ga0395900_0967794
266 Ga0436364_0106688
267 Ga0436364_0108665
268 Ga0436364_0156367
269 Ga0436364_0307361
270 Ga0436364_0419418
271 Ga0436364_0434995
272 Ga0436364_0607776
273 Ga0436364_0642948
274 Ga0436364_0944751
275 Ga0436364_1068168
276 Ga0436364_1073325
277 Ga0436364_1111350
278 Ga0436364_1201710
279 Ga0436364_1416805
280 Ga0436364_1417422
281 Ga0436365_0504905
282 Ga0436365_0610776
283 Ga0436365_0666440
284 Ga0436365_0752961
285 Ga0436365_0879280
286 Ga0436365_0883864
287 Ga0436365_1135140
288 Ga0436365_1339549
289 Ga0436360_1204046
290 Ga0436361_0538573
291 Ga0436361_0815288
292 Ga0436363_0379772
293 Ga0436363_0512378
294 Ga0436363_0701529
295 Ga0436363_0797115
296 Ga0436363_1036278
297 Ga0436362_0092264
298 Ga0436362_0105512
299 Ga0436362_0108738
300 Ga0436362_0121883
301 Ga0436362_0389092
302 Ga0466966_0056416
303 Ga0466959_0460398
304 Ga0466958_0181781
305 Ga0466958_0976432
306 Ga0466967_0197480
307 Ga0466967_0799090
308 Ga0466967_1047237
309 Ga0495580_0072943
310 Ga0496109_0644944
311 Ga0496109_1354373
312 Ga0496112_0014093
313 Ga0496115_0033032
314 Ga0496126_1081644
315 Ga0501037_0116373
316 Ga0501043_0593384
317 Ga0501046_1217504
318 Ga0501047_0060795
319 Ga0501047_0068933
320 Ga0501074_0673826
321 Ga0501080_0397755
322 Ga0501035_0173772
323 Ga0501044_0000499
324 Ga0501044_0002734
325 Ga0501044_0132013
326 Ga0495601_0101363
327 Ga0501084_0679160
328 Ga0501082_1378336

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08899

DUF1844

Domain of unknown function (DUF1844)

15

92

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4uic-assembly1.cif.gz_A crystal structure of the s-layer protein rsbsc(31-844) 0.8254 20 94
2l3l-assembly1.cif.gz_A the solution structure of the n-terminal domain of human tubulin binding cofactor c reveals a platform for the interaction with ab-tubulin 0.7504 20 97
6d6u-assembly1.cif.gz_E human gaba-a receptor alpha1-beta2-gamma2 subtype in complex with gaba and flumazenil, conformation a 0.7356 20 103
6xr2-assembly2.cif.gz_F computationally designed right-handed alpha/alpha homotrimeric toroid with 3 repeats per subunit 0.7044 19 101
2luh-assembly1.cif.gz_A nmr structure of the vta1-vps60 complex 0.6949 20 98
ID Description Score Start End Superfamily
af_Q15814_30_135_1.20.58.1250 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Tubulin Binding Cofactor C, N-terminal domain 0.8417 20 98 1.20.58.1250
af_Q8VCN9_29_134_1.20.58.1250 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Tubulin Binding Cofactor C, N-terminal domain 0.8398 20 99 1.20.58.1250
af_A8WGS4_39_224_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.7914 50 99 1.20.1070.10
af_Q57639_17_213_1.20.58.2140 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.7914 20 101 1.20.58.2140
af_F1QJC8_28_137_1.20.58.1250 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Tubulin Binding Cofactor C, N-terminal domain 0.7846 20 98 1.20.58.1250
ID Description Score Start End GO Terms
AF-A0A523IZG6-F1-model_v4 DUF1844 domain-containing protein 0.9395 19 98
AF-A0A1F2RXE5-F1-model_v4 DUF1844 domain-containing protein 0.9312 27 98
AF-A0A372IJN4-F1-model_v4 DUF1844 domain-containing protein 0.9295 14 101
AF-A0A7X7U5M2-F1-model_v4 DUF1844 domain-containing protein 0.9274 14 103
AF-A0A7C3XDV7-F1-model_v4 DUF1844 domain-containing protein 0.9213 11 99

Map