F243745

General Info

Members Datasets Scaffolds Average Seq Length
164 131 105 275

Family's Representative Sequence

Representative Sequence 3300009036|Ga0105244_10023532|Ga0105244_100235323
Length 301
Sequence LALFCFTVVRDVQEDNMTEKNVLFAGDVSLPAIGQGTWYMGENDRHRQKEVDALRAGIDLGLGLIDTAEMYADGGAEEVVGEALRGGLRDKVYLVSKVYPWNAGGKKAIAACEASLRRLNTDYLDLYLLHWRGNFSLAETVEVMETLIQQGKIRRWGVSNLDYSDMQELWRVQGGDACVTDQVLYHLGSRGIEYDLLPWCQQQQMPVMAYCPLAQAGRLRDGLMHNAVVEDIALAHNASAAQILLAWVISHKGVMAIPKAASVAHVEENAAALKITLSGEELALLDNAFPAPGRKTPLDVV

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2547132181 Kosakonia sacchari SP1 Isolate Stem
3 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
4 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
5 2561511199 Enterobacter sp. R4-368 Isolate Nodule
6 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
7 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
8 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
9 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
10 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
11 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
12 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
13 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
14 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
15 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
16 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
17 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
18 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
19 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
20 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
21 2738543010 Bacillus sp. YR335 Isolate Unclassified
22 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
23 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
24 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
25 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
26 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
27 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
28 2847085930 Erwinia persicina B64 Isolate Bulb
29 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
30 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
31 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
32 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
33 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
34 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
35 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
36 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
37 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
38 2904504865 Serratia marcescens 1822 Isolate Unclassified
39 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
40 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
41 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
42 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
43 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
44 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
45 2952252522 Salinicola sp. DM10 Isolate Unclassified
46 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
47 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
48 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
49 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
50 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
51 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
52 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
53 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
54 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
55 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
56 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
57 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
58 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
59 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
60 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
61 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
62 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
63 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
76 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
85 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
95 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
96 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
97 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
98 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
99 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
100 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
101 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
102 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
103 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
104 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
105 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
106 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
107 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
108 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
109 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
110 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
111 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
112 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
113 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
114 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
115 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
116 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
118 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
119 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
120 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
121 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
122 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
123 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
124 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
125 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
126 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
127 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
128 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
129 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
130 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
131 8054795415 Paenibacillus periandrae PM10 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 64.02
Metatranscriptomes 0
Isolates 35.98

Biome Distribution

Category Percentage (%)
Aerial Root 1.22
Bulb 0.61
Endosphere 9.15
Nodule 1.22
Rhizoplane 7.93
Rhizosphere 61.59
Stem 0.61
Stem Tuber 0
Unclassified 17.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C7418 2010549000 Bacteria 1332
2 Ga0055541_1002028 3300003841 Bacteria 4145
3 Ga0058692_1000369 3300003856 Bacteria 21701
4 Ga0058692_1001233 3300003856 Bacteria 9800
5 Ga0065704_10213265 3300005289 Bacteria 1101
6 Ga0070690_100225118 3300005330 Bacteria 1316
7 Ga0070668_100008272 3300005347 Bacteria 7721
8 Ga0070668_100114629 3300005347 Bacteria 2147
9 Ga0070686_100560875 3300005544 Bacteria 895
10 Ga0068861_100423448 3300005719 Bacteria 1187
11 Ga0075365_10004188 3300006038 Bacteria 7595
12 Ga0075365_10031441 3300006038 Bacteria 3405
13 Ga0075363_100013234 3300006048 Bacteria 3993
14 Ga0075364_10223802 3300006051 Bacteria 1277
15 Ga0075367_10028653 3300006178 Bacteria 3178
16 Ga0075370_10240794 3300006353 Bacteria 1071
17 Ga0075428_100002242 3300006844 Bacteria 20932
18 Ga0075428_100196584 3300006844 Bacteria 2181
19 Ga0075428_100232478 3300006844 Bacteria 1989
20 Ga0075428_100461627 3300006844 Bacteria 1360
21 Ga0075428_100672539 3300006844 Bacteria 1103
22 Ga0075430_100020322 3300006846 Bacteria 5649
23 Ga0075430_100041360 3300006846 Bacteria 3900
24 Ga0075430_100111363 3300006846 Bacteria 2282
25 Ga0075431_100024009 3300006847 Bacteria 6244
26 Ga0075431_100040006 3300006847 Bacteria 4830
27 Ga0075431_100292666 3300006847 Bacteria 1647
28 Ga0075431_100396651 3300006847 Bacteria 1381
29 Ga0075434_100057949 3300006871 Bacteria 3850
30 Ga0105244_10023532 3300009036 Bacteria 3375
31 Ga0105250_10000001 3300009092 Bacteria 617357
32 Ga0114129_10045573 3300009147 Bacteria 6164
33 Ga0114129_10074022 3300009147 Bacteria 4745
34 Ga0114129_10317413 3300009147 Bacteria 2072
35 Ga0114129_10764541 3300009147 Bacteria 1236
36 Ga0157373_10000307 3300013100 Bacteria 39624
37 Ga0157380_10138624 3300014326 Bacteria 2086
38 Ga0157379_10491598 3300014968 Bacteria 1136
39 Ga0182006_1000047 3300015261 Bacteria 187006
40 Ga0213876_10000191 3300021384 Bacteria 64044
41 Ga0209566_100072 3300025225 Bacteria 167764
42 Ga0209437_102137 3300025233 Bacteria 3982
43 Ga0207696_1000015 3300025711 Bacteria 507848
44 Ga0207655_1097725 3300025728 Bacteria 1018
45 Ga0207713_1005289 3300025735 Bacteria 8119
46 Ga0207668_10127182 3300025972 Bacteria 1940
47 Ga0207675_100023415 3300026118 Bacteria 5745
48 Ga0207675_100111661 3300026118 Bacteria 2579
49 Ga0209371_1000002 3300027312 Bacteria 1551985
50 Ga0209371_1000157 3300027312 Bacteria 106573
51 Ga0209371_1000305 3300027312 Bacteria 54719
52 Ga0209813_10006753 3300027866 Bacteria 2843
53 Ga0207428_10120004 3300027907 Bacteria 2017
54 Ga0268265_10077721 3300028380 Bacteria 2608
55 Ga0268256_1000002 3300030500 Bacteria 1535763
56 Ga0268256_1000098 3300030500 Bacteria 136395
57 Ga0268256_1011488 3300030500 Bacteria 2797
58 Ga0373935_0646830 3300035692 Bacteria 775
59 Ga0373925_0397471 3300037068 Bacteria 1124
60 Ga0436365_1037676 3300039437 Bacteria 170132
61 Ga0439438_017967 3300041405 Bacteria 2023
62 Ga0439452_000002 3300042010 Bacteria 1377577
63 Ga0451577_0100641 3300042876 Bacteria 2582
64 Ga0451577_0489140 3300042876 Bacteria 1117
65 Ga0495590_0077996 3300046457 Bacteria 1166
66 Ga0495596_0010870 3300046500 Bacteria 3947
67 Ga0495676_0555155 3300047321 Bacteria 750
68 Ga0495681_0011986 3300047470 Bacteria 5120
69 Ga0496104_0003145 3300048907 Bacteria 14225
70 Ga0496106_0325395 3300048909 Bacteria 1234
71 Ga0496109_0107896 3300048912 Bacteria 2587
72 Ga0496109_0476070 3300048912 Bacteria 1179
73 Ga0496110_0016516 3300048913 Bacteria 6163
74 Ga0496112_0011008 3300048915 Bacteria 8243
75 Ga0496116_0000467 3300048919 Bacteria 55852
76 Ga0496116_0135051 3300048919 Bacteria 1399
77 Ga0496116_0140000 3300048919 Bacteria 1363
78 Ga0496117_0076893 3300048920 Bacteria 2211
79 Ga0496122_0021391 3300048925 Bacteria 5792
80 Ga0496123_0000078 3300048926 Bacteria 191819
81 Ga0496123_0029015 3300048926 Bacteria 4084
82 Ga0496125_0154187 3300048928 Bacteria 1572
83 Ga0495682_0000001 3300049460 Bacteria 1559116
84 Ga0501034_0019381 3300049571 Bacteria 6958
85 Ga0501075_0050746 3300049591 Bacteria 3119
86 Ga0501076_0098957 3300049592 Bacteria 2350
87 Ga0501079_0471195 3300049741 Bacteria 987
88 Ga0501044_0255499 3300049823 Bacteria 1692
89 nmdc:mga03n38_14221_c1 3300050490 Bacteria 3044
90 nmdc:mga0yw44_40129_c1 3300050492 Bacteria 2779
91 nmdc:mga0yw44_6738_c1 3300050492 Bacteria 5579
92 nmdc:mga06z11_18453_c1 3300050494 Bacteria 3187
93 nmdc:mga05p37_137968_c2 3300050507 Bacteria 2155
94 nmdc:mga05p37_276453_c1 3300050507 Bacteria 2005
95 nmdc:mga05p37_457038_c1 3300050507 Bacteria 1476
96 nmdc:mga05p37_986709_c1 3300050507 Bacteria 897
97 nmdc:mga09592_199912_c1 3300050508 Bacteria 1731
98 nmdc:mga0qj67_104178_c1 3300050509 Bacteria 2289
99 nmdc:mga0qj67_109799_c1 3300050509 Bacteria 2226
100 nmdc:mga0qj67_15818_c1 3300050509 Bacteria 5713
101 nmdc:mga06r32_123310_c1 3300050510 Bacteria 2557
102 nmdc:mga06r32_28430_c1 3300050510 Bacteria 5231
103 nmdc:mga06r32_337562_c1 3300050510 Bacteria 1492
104 nmdc:mga08y16_41630_c1 3300050511 Bacteria 4812
105 Ga0501082_0122132 3300060353 Bacteria 2258

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035692 Ga0373935_0646830 Ga0373935_0646830_43_723 226
2 3300047321 Ga0495676_0555155 Ga0495676_0555155_19_714 231
3 3300048919 Ga0496116_0135051 Ga0496116_0135051_131_826 231
4 3300050490 nmdc:mga03n38_14221_c1 nmdc:mga03n38_14221_c1_2257_3027 237
5 3300049741 Ga0501079_0471195 Ga0501079_0471195_127_960 241
6 3300014968 Ga0157379_10491598 Ga0157379_104915981 242
7 3300049591 Ga0501075_0050746 Ga0501075_0050746_2217_3068 244
8 3300049592 Ga0501076_0098957 Ga0501076_0098957_1389_2240 244
9 3300006844 Ga0075428_100196584 Ga0075428_1001965842 254
10 3300006844 Ga0075428_100461627 Ga0075428_1004616272 254
11 3300006846 Ga0075430_100020322 Ga0075430_1000203225 254
12 3300006847 Ga0075431_100040006 Ga0075431_1000400063 254
13 3300009147 Ga0114129_10317413 Ga0114129_103174134 254
14 3300048909 Ga0496106_0325395 Ga0496106_0325395_22_786 254
15 3300050507 nmdc:mga05p37_276453_c1 nmdc:mga05p37_276453_c1_266_1030 254
16 3300005347 Ga0070668_100114629 Ga0070668_1001146292 255
17 3300006048 Ga0075363_100013234 Ga0075363_1000132342 255
18 3300006353 Ga0075370_10240794 Ga0075370_102407942 255
19 3300006844 Ga0075428_100232478 Ga0075428_1002324782 255
20 3300009147 Ga0114129_10764541 Ga0114129_107645412 255
21 3300025972 Ga0207668_10127182 Ga0207668_101271822 255
22 3300026118 Ga0207675_100023415 Ga0207675_1000234152 255
23 3300027866 Ga0209813_10006753 Ga0209813_100067531 255
24 3300027907 Ga0207428_10120004 Ga0207428_101200041 255
25 3300028380 Ga0268265_10077721 Ga0268265_100777212 255
26 3300048907 Ga0496104_0003145 Ga0496104_0003145_4609_5442 255
27 3300048912 Ga0496109_0107896 Ga0496109_0107896_1560_2393 255
28 3300048913 Ga0496110_0016516 Ga0496110_0016516_2184_3017 255
29 3300048915 Ga0496112_0011008 Ga0496112_0011008_3482_4315 255
30 3300050511 nmdc:mga08y16_41630_c1 nmdc:mga08y16_41630_c1_2819_3652 255
31 3300006038 Ga0075365_10004188 Ga0075365_100041887 256
32 3300006038 Ga0075365_10031441 Ga0075365_100314413 256
33 3300006051 Ga0075364_10223802 Ga0075364_102238022 256
34 3300006178 Ga0075367_10028653 Ga0075367_100286535 256
35 3300014326 Ga0157380_10138624 Ga0157380_101386242 256
36 3300050492 nmdc:mga0yw44_40129_c1 nmdc:mga0yw44_40129_c1_155_988 256
37 3300050492 nmdc:mga0yw44_6738_c1 nmdc:mga0yw44_6738_c1_1252_2085 256
38 3300050494 nmdc:mga06z11_18453_c1 nmdc:mga06z11_18453_c1_154_987 256
39 3300006846 Ga0075430_100111363 Ga0075430_1001113633 257
40 3300006847 Ga0075431_100292666 Ga0075431_1002926662 257
41 3300006847 Ga0075431_100396651 Ga0075431_1003966512 257
42 3300050508 nmdc:mga09592_199912_c1 nmdc:mga09592_199912_c1_207_1040 257
43 3300050509 nmdc:mga0qj67_104178_c1 nmdc:mga0qj67_104178_c1_104_937 257
44 3300050510 nmdc:mga06r32_28430_c1 nmdc:mga06r32_28430_c1_1821_2654 257
45 3300037068 Ga0373925_0397471 Ga0373925_0397471_183_1049 260
46 3300050507 nmdc:mga05p37_457038_c1 nmdc:mga05p37_457038_c1_102_935 260
47 3300003841 Ga0055541_1002028 Ga0055541_10020285 261
48 3300025225 Ga0209566_100072 Ga0209566_10007210 261
49 3300047470 Ga0495681_0011986 Ga0495681_0011986_2987_3772 261
50 iso_pu_bacteria 2579778775 2580935108 262
51 3300006871 Ga0075434_100057949 Ga0075434_1000579492 275
52 3300009147 Ga0114129_10074022 Ga0114129_100740224 275
53 3300048912 Ga0496109_0476070 Ga0496109_0476070_285_1115 275
54 3300050507 nmdc:mga05p37_986709_c1 nmdc:mga05p37_986709_c1_38_865 275
55 3300050509 nmdc:mga0qj67_15818_c1 nmdc:mga0qj67_15818_c1_4759_5586 275
56 3300050510 nmdc:mga06r32_337562_c1 nmdc:mga06r32_337562_c1_384_1211 275
57 iso_pu_bacteria 2889049205 2889051981 276
58 3300005330 Ga0070690_100225118 Ga0070690_1002251182 277
59 3300005544 Ga0070686_100560875 Ga0070686_1005608751 277
60 3300005719 Ga0068861_100423448 Ga0068861_1004234481 277
61 3300006844 Ga0075428_100002242 Ga0075428_1000022429 277
62 3300006844 Ga0075428_100672539 Ga0075428_1006725392 277
63 3300006846 Ga0075430_100041360 Ga0075430_1000413604 277
64 3300006847 Ga0075431_100024009 Ga0075431_1000240091 277
65 3300009147 Ga0114129_10045573 Ga0114129_100455736 277
66 3300026118 Ga0207675_100111661 Ga0207675_1001116613 277
67 3300049571 Ga0501034_0019381 Ga0501034_0019381_3826_4659 277
68 3300050507 nmdc:mga05p37_137968_c2 nmdc:mga05p37_137968_c2_631_1464 277
69 3300050509 nmdc:mga0qj67_109799_c1 nmdc:mga0qj67_109799_c1_1128_1961 277
70 3300050510 nmdc:mga06r32_123310_c1 nmdc:mga06r32_123310_c1_42_875 277
71 3300060353 Ga0501082_0122132 Ga0501082_0122132_719_1552 277
72 iso_pu_bacteria 2687453129 2687578591 278
73 3300042876 Ga0451577_0489140 Ga0451577_0489140_232_1071 279
74 3300049823 Ga0501044_0255499 Ga0501044_0255499_426_1292 279
75 iso_pu_bacteria 2847085930 2847087398 279
76 3300048919 Ga0496116_0000467 Ga0496116_0000467_27800_28645 280
77 iso_pu_bacteria 2711768156 2712469605 280
78 iso_pu_bacteria 2791355275 2793405825 280
79 iso_pu_bacteria 2547132181 2547695097 281
80 iso_pu_bacteria 2561511199 2562463039 281
81 iso_pu_bacteria 2600255256 2601535187 281
82 iso_pu_bacteria 2600255257 2601540750 281
83 iso_pu_bacteria 2600255310 2601758369 281
84 iso_pu_bacteria 2600255311 2601764478 281
85 iso_pu_bacteria 2602042046 2603638271 281
86 iso_pu_bacteria 2609459761 2609910164 281
87 iso_pu_bacteria 2791355010 2792311396 281
88 iso_pu_bacteria 2811995292 2813729305 281
89 iso_pu_bacteria 2814123068 2814696815 281
90 iso_pu_bacteria 2904504865 2904507647 281
91 iso_pu_bacteria 2945874760 2945877366 281
92 iso_pu_bacteria 2984527788 2984532300 281
93 iso_pu_bacteria 2984532647 2984533560 281
94 3300013100 Ga0157373_10000307 Ga0157373_1000030740 282
95 3300025735 Ga0207713_1005289 Ga0207713_10052892 282
96 3300048919 Ga0496116_0140000 Ga0496116_0140000_213_1061 282
97 3300003856 Ga0058692_1000369 Ga0058692_100036917 283
98 3300027312 Ga0209371_1000157 Ga0209371_100015716 283
99 3300030500 Ga0268256_1000098 Ga0268256_1000098120 283
100 3300042876 Ga0451577_0100641 Ga0451577_0100641_1225_2079 283
101 3300046500 Ga0495596_0010870 Ga0495596_0010870_1869_2720 283
102 iso_pu_bacteria 2548877040 2550900061 283
103 iso_pu_bacteria 2571042143 2571531546 283
104 iso_pu_bacteria 2600255286 2601639488 283
105 iso_pu_bacteria 2728368933 2728530208 283
106 iso_pu_bacteria 2971403814 2971408645 283
107 iso_pu_bacteria 2988225383 2988230197 283
108 iso_pu_bacteria 8054465665 8054467024 283
109 3300005289 Ga0065704_10213265 Ga0065704_102132651 284
110 3300005347 Ga0070668_100008272 Ga0070668_1000082724 284
111 3300009092 Ga0105250_10000001 Ga0105250_1000000164 284
112 3300015261 Ga0182006_1000047 Ga0182006_1000047160 284
113 3300025233 Ga0209437_102137 Ga0209437_1021373 284
114 3300025711 Ga0207696_1000015 Ga0207696_1000015240 284
115 3300025728 Ga0207655_1097725 Ga0207655_10977251 284
116 3300041405 Ga0439438_017967 Ga0439438_017967_512_1366 284
117 3300042010 Ga0439452_000002 Ga0439452_000002_1351990_1352844 284
118 3300046457 Ga0495590_0077996 Ga0495590_0077996_130_993 284
119 3300048920 Ga0496117_0076893 Ga0496117_0076893_592_1461 284
120 3300049460 Ga0495682_0000001 Ga0495682_0000001_711931_712815 284
121 iso_pu_bacteria 2554235469 2556065166 284
122 iso_pu_bacteria 2571042588 2573037733 284
123 iso_pu_bacteria 2576861424 2578336029 284
124 iso_pu_bacteria 2643221543 2643737207 284
125 iso_pu_bacteria 2738543010 2739233999 284
126 iso_pu_bacteria 2821111986 2821115590 284
127 iso_pu_bacteria 2831905167 2831907673 284
128 iso_pu_bacteria 2857604169 2857606062 284
129 iso_pu_bacteria 2864997549 2865001802 284
130 iso_pu_bacteria 2881636855 2881639534 284
131 iso_pu_bacteria 2885526491 2885531103 284
132 iso_pu_bacteria 2889042446 2889043646 284
133 iso_pu_bacteria 2889295896 2889299560 284
134 iso_pu_bacteria 2904162308 2904166635 284
135 iso_pu_bacteria 2904490793 2904495159 284
136 iso_pu_bacteria 2919160200 2919163648 284
137 iso_pu_bacteria 2931384279 2931387107 284
138 iso_pu_bacteria 2938649242 2938654672 284
139 iso_pu_bacteria 2945991243 2945994300 284
140 iso_pu_bacteria 2946053406 2946057062 284
141 iso_pu_bacteria 2952252522 2952254625 284
142 iso_pu_bacteria 2968558590 2968564619 284
143 iso_pu_bacteria 2971511577 2971515077 284
144 iso_pu_bacteria 2980125574 2980130589 284
145 iso_pu_bacteria 2980176882 2980181171 284
146 iso_pu_bacteria 2981284811 2981288665 284
147 iso_pu_bacteria 2981289755 2981293486 284
148 iso_pu_bacteria 2981980479 2981984277 284
149 iso_pu_bacteria 2981985349 2981989203 284
150 iso_pu_bacteria 2996632988 2996636332 284
151 iso_pu_bacteria 8054795415 8054799435 284
152 2010549000 RicEn_C7418 RicEn_130640 285
153 3300003856 Ga0058692_1001233 Ga0058692_10012333 285
154 3300009036 Ga0105244_10023532 Ga0105244_100235323 285
155 3300021384 Ga0213876_10000191 Ga0213876_1000019138 285
156 3300027312 Ga0209371_1000002 Ga0209371_100000283 285
157 3300027312 Ga0209371_1000305 Ga0209371_10003053 285
158 3300030500 Ga0268256_1000002 Ga0268256_10000021381 285
159 3300030500 Ga0268256_1011488 Ga0268256_10114883 285
160 3300039437 Ga0436365_1037676 Ga0436365_1037676_38730_39635 285
161 3300048925 Ga0496122_0021391 Ga0496122_0021391_2683_3588 285
162 3300048926 Ga0496123_0000078 Ga0496123_0000078_113740_114645 285
163 3300048926 Ga0496123_0029015 Ga0496123_0029015_1301_2206 285
164 3300048928 Ga0496125_0154187 Ga0496125_0154187_321_1226 285

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

32

289

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wgh-assembly1.cif.gz_A crystal structure of aldo/keto reductase from klebsiella pneumoniae in complex with nadp and acetate at 1.8 a resolution 0.9704 2 285
6cia-assembly1.cif.gz_A crystal structure of aldo-keto reductase from klebsiella pneumoniae in complex with nadph. 0.97 1 285
4wgh-assembly1.cif.gz_A crystal structure of aldo/keto reductase from klebsiella pneumoniae in complex with nadp and acetate at 1.8 a resolution 0.9671 2 285
6cia-assembly1.cif.gz_A crystal structure of aldo-keto reductase from klebsiella pneumoniae in complex with nadph. 0.9666 1 285
4xap-assembly1.cif.gz_A crystal structure of aldo-keto reductase from sinorhizobium meliloti 1021 0.9661 1 285
ID Description Score Start End Superfamily
4xapA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9661 1 285 3.20.20.100
4xapA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9561 1 285 3.20.20.100
5danA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9077 1 270 3.20.20.100
af_Q7XCS4_50_365_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9003 12 274 3.20.20.100
af_P9WQA7_10_309_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8959 12 281 3.20.20.100
ID Description Score Start End GO Terms
AF-W1XLZ6-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 1.003 37 141 GO:0016491
AF-A0A529HJM2-F1-model_v4 Aldo/keto reductase 1.001 96 194 GO:0016491
AF-A0A2X3LYU5-F1-model_v4 Aldehyde reductase (EC 1.1.1.-) 0.9991 31 156 GO:0016491
AF-A0A3L7B7F9-F1-model_v4 deleted 0.9976 49 200
AF-A0A7H4LUR4-F1-model_v4 Oxidoreductase YeaE (EC 1.1.1.-) 0.9974 64 193 GO:0016491

Feature Viewer

pLDDT pTM Quality
93.69 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map