F243297

General Info

Members Datasets Scaffolds Average Seq Length
164 114 328 149

Family's Representative Sequence

Representative Sequence 3300005437|Ga0070710_10096861|Ga0070710_100968611
Length 167
Sequence MYARPGVAKLEWTERRPEMFKTVVWATDGSESADRALSYAKTLAAEGHGKLVAVFAEEHFVGRSSPYPVLADADELKAKIHEQIAQARSEGLDASFRIVPGITPGSAHMIADAAREEHADAIVAGTRGHGPVAGLLLGSVTQRLLHIAPCPVLVIPSHGTNGAAPAS

Samples

Sample ID Description Type Environment
1 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
23 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
35 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
39 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
40 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
54 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
55 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
56 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
57 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
58 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
59 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
60 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
61 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
62 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
63 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
64 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
65 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
66 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
67 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
68 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
69 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
70 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
71 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
72 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
73 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
74 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
75 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
76 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
77 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
84 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
85 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
86 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
87 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
88 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
89 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
90 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
91 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
92 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
93 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
94 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
95 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
96 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
97 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
98 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
99 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
100 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
101 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
102 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
103 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
104 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
105 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
106 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
107 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
108 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
109 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
110 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
111 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
112 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
113 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
114 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.54
Nodule 0
Rhizoplane 4.27
Rhizosphere 84.76
Stem 0
Stem Tuber 0
Unclassified 28.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070710_10096861 3300005437 Unclassified 1749
2 Ga0070683_100019302 3300005329 Bacteria 6055
3 Ga0070683_100770793 3300005329 Unclassified 922
4 Ga0070690_101705395 3300005330 Unclassified 512
5 Ga0070680_100627362 3300005336 Unclassified 923
6 Ga0070671_101411861 3300005355 Unclassified 615
7 Ga0070673_100424838 3300005364 Bacteria 1192
8 Ga0070709_10109867 3300005434 Unclassified 1852
9 Ga0070714_100037981 3300005435 Bacteria 4049
10 Ga0070714_100202454 3300005435 Bacteria 1816
11 Ga0070714_100360866 3300005435 Bacteria 1366
12 Ga0070714_100457763 3300005435 Unclassified 1212
13 Ga0070714_100950740 3300005435 Bacteria 835
14 Ga0070713_100541947 3300005436 Bacteria 1101
15 Ga0070710_10002707 3300005437 Bacteria 8421
16 Ga0070710_10117007 3300005437 Bacteria 1608
17 Ga0070711_100005495 3300005439 Bacteria 7584
18 Ga0070711_100027493 3300005439 Bacteria 3735
19 Ga0070711_100201136 3300005439 Unclassified 1537
20 Ga0070678_100171139 3300005456 Archaea 1769
21 Ga0070678_101244124 3300005456 Unclassified 691
22 Ga0070681_10122557 3300005458 Bacteria 2533
23 Ga0070698_100464717 3300005471 Archaea 1201
24 Ga0070699_100007597 3300005518 Bacteria 9424
25 Ga0070684_100606391 3300005535 Unclassified 1018
26 Ga0070672_100773982 3300005543 Unclassified 843
27 Ga0070696_100592473 3300005546 Unclassified 893
28 Ga0070664_100214805 3300005564 Unclassified 1719
29 Ga0068857_100179979 3300005577 Unclassified 1924
30 Ga0068870_10429733 3300005840 Unclassified 866
31 Ga0070717_10677825 3300006028 Bacteria 936
32 Ga0070717_11095433 3300006028 Unclassified 725
33 Ga0075368_10135693 3300006042 Bacteria 1024
34 Ga0075363_100012640 3300006048 Bacteria 4071
35 Ga0075363_100127792 3300006048 Bacteria 1424
36 Ga0075364_10003456 3300006051 Bacteria 8986
37 Ga0075364_11126614 3300006051 Bacteria 532
38 Ga0070716_101001042 3300006173 Unclassified 661
39 Ga0070712_100007394 3300006175 Bacteria 6853
40 Ga0070712_100101342 3300006175 Bacteria 2130
41 Ga0070712_100104123 3300006175 Bacteria 2105
42 Ga0070712_100581445 3300006175 Bacteria 946
43 Ga0075367_10154203 3300006178 Bacteria 1426
44 Ga0075431_100624656 3300006847 Bacteria 1059
45 Ga0075436_100336551 3300006914 Bacteria 1086
46 Ga0111539_10147461 3300009094 Bacteria 2755
47 Ga0111539_10764262 3300009094 Bacteria 1125
48 Ga0111539_13106781 3300009094 Bacteria 536
49 Ga0114129_11090952 3300009147 Bacteria 1000
50 Ga0114129_11171469 3300009147 Bacteria 959
51 Ga0105243_10278407 3300009148 Bacteria 1506
52 Ga0105239_12995593 3300010375 Unclassified 551
53 Ga0105246_10100895 3300011119 Bacteria 2101
54 Ga0157374_10574406 3300013296 Unclassified 1136
55 Ga0163162_12581712 3300013306 Unclassified 584
56 Ga0163163_10224223 3300014325 Bacteria 1929
57 Ga0182008_10004276 3300014497 Bacteria 8372
58 Ga0182008_10135715 3300014497 Bacteria 1229
59 Ga0157376_10194461 3300014969 Bacteria 1862
60 Ga0207692_10056583 3300025898 Bacteria 2012
61 Ga0207643_10265476 3300025908 Bacteria 1061
62 Ga0207707_10381751 3300025912 Bacteria 1211
63 Ga0207693_10010126 3300025915 Bacteria 7658
64 Ga0207693_10072726 3300025915 Bacteria 2692
65 Ga0207693_10145602 3300025915 Bacteria 1863
66 Ga0207663_10000960 3300025916 Bacteria 13177
67 Ga0207663_10003983 3300025916 Bacteria 7310
68 Ga0207663_10320154 3300025916 Bacteria 1165
69 Ga0207700_10608124 3300025928 Unclassified 973
70 Ga0207664_10303081 3300025929 Bacteria 1406
71 Ga0207664_10405506 3300025929 Bacteria 1213
72 Ga0207709_11373945 3300025935 Unclassified 585
73 Ga0207704_11177684 3300025938 Unclassified 653
74 Ga0207661_10011726 3300025944 Bacteria 6362
75 Ga0207661_10118132 3300025944 Unclassified 2254
76 Ga0207679_10835585 3300025945 Bacteria 841
77 Ga0207674_10767753 3300026116 Unclassified 930
78 Ga0207683_10236894 3300026121 Archaea 1665
79 Ga0207683_11085006 3300026121 Unclassified 743
80 Ga0209813_10217398 3300027866 Bacteria 714
81 Ga0207428_10250000 3300027907 Bacteria 1322
82 Ga0265337_1139211 3300028556 Bacteria 657
83 Ga0265319_1005412 3300028563 Bacteria 6106
84 Ga0265334_10028957 3300028573 Bacteria 2221
85 Ga0265318_10001451 3300028577 Bacteria 13949
86 Ga0265318_10173850 3300028577 Bacteria 789
87 Ga0265322_10051717 3300028654 Bacteria 1166
88 Ga0265338_10056140 3300028800 Unclassified 3496
89 Ga0265338_10096013 3300028800 Bacteria 2433
90 Ga0265338_10509733 3300028800 Bacteria 846
91 Ga0265330_10091424 3300031235 Bacteria 1306
92 Ga0265328_10105850 3300031239 Bacteria 1044
93 Ga0265320_10010405 3300031240 Bacteria 5543
94 Ga0265325_10009424 3300031241 Bacteria 5699
95 Ga0265329_10038535 3300031242 Bacteria 1537
96 Ga0265339_10152561 3300031249 Bacteria 1167
97 Ga0265327_10011348 3300031251 Bacteria 6144
98 Ga0265316_10094595 3300031344 Bacteria 2276
99 Ga0307408_100880289 3300031548 Unclassified 818
100 Ga0265314_10050303 3300031711 Bacteria 2911
101 Ga0265342_10072709 3300031712 Bacteria 2001
102 Ga0265342_10207219 3300031712 Bacteria 1062
103 Ga0307406_11330827 3300031901 Bacteria 628
104 Ga0307407_11083646 3300031903 Unclassified 622
105 Ga0307409_100033191 3300031995 Bacteria 3753
106 Ga0307416_100045829 3300032002 Bacteria 3446
107 Ga0307415_100062260 3300032126 Bacteria 2587
108 Ga0373937_1258573 3300036401 Unclassified 688
109 Ga0395899_0120515 3300037312 Bacteria 1879
110 Ga0395900_0047750 3300037418 Bacteria 4410
111 Ga0395900_0341599 3300037418 Bacteria 1472
112 Ga0395898_0009976 3300037466 Bacteria 9948
113 Ga0395898_0032585 3300037466 Bacteria 5202
114 Ga0395898_1131048 3300037466 Unclassified 716
115 Ga0395905_0096215 3300037471 Bacteria 2780
116 Ga0395905_0132600 3300037471 Bacteria 2343
117 Ga0395901_0046447 3300038443 Bacteria 4511
118 Ga0395901_0238172 3300038443 Bacteria 1898
119 Ga0395901_1208893 3300038443 Bacteria 721
120 Ga0436363_0208910 3300039450 Bacteria 958
121 Ga0436363_0234938 3300039450 Unclassified 1006
122 Ga0451853_2781693 3300041512 Bacteria 8494
123 Ga0451853_3601016 3300041512 Unclassified 2560
124 Ga0466964_0376309 3300044706 Unclassified 736
125 Ga0466957_0378655 3300044842 Bacteria 965
126 Ga0466958_0012925 3300045836 Bacteria 4742
127 Ga0466958_0075928 3300045836 Bacteria 2062
128 Ga0466967_0044938 3300045976 Bacteria 3836
129 Ga0466967_0134824 3300045976 Bacteria 2295
130 Ga0466967_0515971 3300045976 Bacteria 1174
131 Ga0466967_0692042 3300045976 Unclassified 1009
132 Ga0466967_1156643 3300045976 Bacteria 771
133 Ga0495653_0657145 3300046463 Bacteria 640
134 Ga0495639_0148549 3300046475 Bacteria 1130
135 Ga0495608_0176554 3300046511 Unclassified 1353
136 Ga0495608_0567255 3300046511 Bacteria 683
137 Ga0495630_0607908 3300046517 Bacteria 838
138 Ga0495635_0177713 3300046663 Unclassified 1447
139 Ga0495588_0158788 3300046674 Bacteria 1195
140 Ga0495623_0645264 3300046679 Bacteria 546
141 Ga0495600_0483324 3300046809 Bacteria 763
142 Ga0495604_0690515 3300047317 Bacteria 649
143 Ga0495674_0226571 3300047319 Bacteria 1544
144 Ga0495602_0281121 3300048088 Unclassified 1226
145 Ga0496100_0650098 3300048903 Unclassified 821
146 Ga0496109_0207226 3300048912 Unclassified 1844
147 Ga0496112_0151312 3300048915 Unclassified 2288
148 Ga0496112_0581783 3300048915 Unclassified 1052
149 Ga0496112_1278952 3300048915 Unclassified 649
150 Ga0496114_0325888 3300048917 Bacteria 1358
151 Ga0496114_0839760 3300048917 Bacteria 798
152 Ga0501067_0146814 3300049583 Bacteria 1314
153 Ga0501073_0305137 3300049589 Bacteria 1098
154 Ga0501044_1276319 3300049823 Bacteria 601
155 nmdc:mga03n38_545315_c1 3300050490 Bacteria 655
156 nmdc:mga00v17_41079_c1 3300050491 Bacteria 2777
157 nmdc:mga00v17_7033_c1 3300050491 Bacteria 5992
158 nmdc:mga0yw44_139592_c1 3300050492 Bacteria 1574
159 nmdc:mga0yw44_242656_c1 3300050492 Bacteria 1198
160 nmdc:mga06z11_142065_c1 3300050494 Bacteria 1358
161 nmdc:mga04h51_247297_c1 3300050495 Bacteria 714
162 nmdc:mga06r32_702067_c1 3300050510 Unclassified 977
163 nmdc:mga08y16_445963_c1 3300050511 Unclassified 1320
164 Ga0495601_0051522 3300053077 Unclassified 2598
165 Ga0070710_10096861
166 Ga0070683_100019302
167 Ga0070683_100770793
168 Ga0070690_101705395
169 Ga0070680_100627362
170 Ga0070671_101411861
171 Ga0070673_100424838
172 Ga0070709_10109867
173 Ga0070714_100037981
174 Ga0070714_100202454
175 Ga0070714_100360866
176 Ga0070714_100457763
177 Ga0070714_100950740
178 Ga0070713_100541947
179 Ga0070710_10002707
180 Ga0070710_10117007
181 Ga0070711_100005495
182 Ga0070711_100027493
183 Ga0070711_100201136
184 Ga0070678_100171139
185 Ga0070678_101244124
186 Ga0070681_10122557
187 Ga0070698_100464717
188 Ga0070699_100007597
189 Ga0070684_100606391
190 Ga0070672_100773982
191 Ga0070696_100592473
192 Ga0070664_100214805
193 Ga0068857_100179979
194 Ga0068870_10429733
195 Ga0070717_10677825
196 Ga0070717_11095433
197 Ga0075368_10135693
198 Ga0075363_100012640
199 Ga0075363_100127792
200 Ga0075364_10003456
201 Ga0075364_11126614
202 Ga0070716_101001042
203 Ga0070712_100007394
204 Ga0070712_100101342
205 Ga0070712_100104123
206 Ga0070712_100581445
207 Ga0075367_10154203
208 Ga0075431_100624656
209 Ga0075436_100336551
210 Ga0111539_10147461
211 Ga0111539_10764262
212 Ga0111539_13106781
213 Ga0114129_11090952
214 Ga0114129_11171469
215 Ga0105243_10278407
216 Ga0105239_12995593
217 Ga0105246_10100895
218 Ga0157374_10574406
219 Ga0163162_12581712
220 Ga0163163_10224223
221 Ga0182008_10004276
222 Ga0182008_10135715
223 Ga0157376_10194461
224 Ga0207692_10056583
225 Ga0207643_10265476
226 Ga0207707_10381751
227 Ga0207693_10010126
228 Ga0207693_10072726
229 Ga0207693_10145602
230 Ga0207663_10000960
231 Ga0207663_10003983
232 Ga0207663_10320154
233 Ga0207700_10608124
234 Ga0207664_10303081
235 Ga0207664_10405506
236 Ga0207709_11373945
237 Ga0207704_11177684
238 Ga0207661_10011726
239 Ga0207661_10118132
240 Ga0207679_10835585
241 Ga0207674_10767753
242 Ga0207683_10236894
243 Ga0207683_11085006
244 Ga0209813_10217398
245 Ga0207428_10250000
246 Ga0265337_1139211
247 Ga0265319_1005412
248 Ga0265334_10028957
249 Ga0265318_10001451
250 Ga0265318_10173850
251 Ga0265322_10051717
252 Ga0265338_10056140
253 Ga0265338_10096013
254 Ga0265338_10509733
255 Ga0265330_10091424
256 Ga0265328_10105850
257 Ga0265320_10010405
258 Ga0265325_10009424
259 Ga0265329_10038535
260 Ga0265339_10152561
261 Ga0265327_10011348
262 Ga0265316_10094595
263 Ga0307408_100880289
264 Ga0265314_10050303
265 Ga0265342_10072709
266 Ga0265342_10207219
267 Ga0307406_11330827
268 Ga0307407_11083646
269 Ga0307409_100033191
270 Ga0307416_100045829
271 Ga0307415_100062260
272 Ga0373937_1258573
273 Ga0395899_0120515
274 Ga0395900_0047750
275 Ga0395900_0341599
276 Ga0395898_0009976
277 Ga0395898_0032585
278 Ga0395898_1131048
279 Ga0395905_0096215
280 Ga0395905_0132600
281 Ga0395901_0046447
282 Ga0395901_0238172
283 Ga0395901_1208893
284 Ga0436363_0208910
285 Ga0436363_0234938
286 Ga0451853_2781693
287 Ga0451853_3601016
288 Ga0466964_0376309
289 Ga0466957_0378655
290 Ga0466958_0012925
291 Ga0466958_0075928
292 Ga0466967_0044938
293 Ga0466967_0134824
294 Ga0466967_0515971
295 Ga0466967_0692042
296 Ga0466967_1156643
297 Ga0495653_0657145
298 Ga0495639_0148549
299 Ga0495608_0176554
300 Ga0495608_0567255
301 Ga0495630_0607908
302 Ga0495635_0177713
303 Ga0495588_0158788
304 Ga0495623_0645264
305 Ga0495600_0483324
306 Ga0495604_0690515
307 Ga0495674_0226571
308 Ga0495602_0281121
309 Ga0496100_0650098
310 Ga0496109_0207226
311 Ga0496112_0151312
312 Ga0496112_0581783
313 Ga0496112_1278952
314 Ga0496114_0325888
315 Ga0496114_0839760
316 Ga0501067_0146814
317 Ga0501073_0305137
318 Ga0501044_1276319
319 nmdc:mga03n38_545315_c1
320 nmdc:mga00v17_41079_c1
321 nmdc:mga00v17_7033_c1
322 nmdc:mga0yw44_139592_c1
323 nmdc:mga0yw44_242656_c1
324 nmdc:mga06z11_142065_c1
325 nmdc:mga04h51_247297_c1
326 nmdc:mga06r32_702067_c1
327 nmdc:mga08y16_445963_c1
328 Ga0495601_0051522

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00582

Usp

Universal stress protein family

19

156

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wak-assembly1.cif.gz_A glutamyl-trna synthetase from plasmodium falciparum (pfers) in complex with adp 0.788 3 37
1nzj-assembly1.cif.gz_A crystal structure and activity studies of escherichia coli yadb orf 0.7671 1 37
3loq-assembly2.cif.gz_B the crystal structure of a universal stress protein from archaeoglobus fulgidus dsm 4304 0.7359 4 113
2hnh-assembly1.cif.gz_A crystal structure of the catalytic alpha subunit of e. coli replicative dna polymerase iii 0.7255 6 35
5ahw-assembly2.cif.gz_C crystal structure of universal stress protein msmeg_3811 in complex with camp 0.721 2 114
ID Description Score Start End Superfamily
af_Q57909_42_335_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8072 3 37 3.40.50.620
af_Q6ZJ60_540_767_3.40.50.12370 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7821 3 37 3.40.50.12370
af_P77216_3_243_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7472 1 39 3.40.50.620
af_K7KXA2_2_94_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7453 3 36 3.40.50.2000
af_Q57951_25_170_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.729 1 117 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A1E4ILL6-F1-model_v4 UspA domain-containing protein 0.7912 1 114
AF-U5QIY8-F1-model_v4 UspA domain-containing protein 0.786 1 113
AF-A0A2V8EXH5-F1-model_v4 UspA domain-containing protein 0.7727 2 118
AF-A0A7C2YR24-F1-model_v4 Divalent metal cation transporter MntH 0.7699 2 112 GO:0005384
GO:0005886
GO:0012505
GO:0015086
GO:0015293
GO:0034755
GO:0046872
AF-A0A285VCM2-F1-model_v4 Universal stress protein family protein 0.7687 3 116

Map