F243151

General Info

Members Datasets Scaffolds Average Seq Length
164 124 164 50

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100000520|Ga0068868_1000005209
Length 51
Sequence MYNRLGKASIKFAFRYARRRYRREVRIGLGVLGAGVVALVAYLATREVPEG

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
45 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
71 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
72 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
73 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
74 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
75 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
76 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
77 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
78 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
79 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
80 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
81 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
82 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
83 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
84 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
85 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
86 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
87 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
88 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
89 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
90 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
91 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
92 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
93 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
94 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
95 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
96 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
97 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
98 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
99 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
100 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
101 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
102 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
103 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
104 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
105 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
106 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
107 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
108 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
109 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
110 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
111 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
112 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
113 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
114 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
115 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
116 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
117 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
118 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
120 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
121 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
122 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
123 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
124 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.76
Rhizosphere 87.8
Stem 0
Stem Tuber 0
Unclassified 2.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1008695 3300000546 Bacteria 1088
2 JGI24751J29686_10032552 3300002459 Bacteria 1081
3 Ga0070683_100318534 3300005329 Bacteria 1480
4 Ga0070682_100267300 3300005337 Bacteria 1241
5 Ga0068868_100000225 3300005338 Bacteria 38457
6 Ga0068868_100000520 3300005338 Bacteria 25795
7 Ga0070691_10000708 3300005341 Bacteria 13032
8 Ga0070661_100000035 3300005344 Bacteria 111363
9 Ga0070668_100095815 3300005347 Bacteria 2345
10 Ga0070667_100189292 3300005367 Bacteria 1822
11 Ga0070667_100588582 3300005367 Bacteria 1024
12 Ga0070714_100509800 3300005435 Bacteria 1148
13 Ga0070713_100000054 3300005436 Bacteria 71191
14 Ga0070701_10362953 3300005438 Unclassified 908
15 Ga0070711_100032920 3300005439 Bacteria 3450
16 Ga0070711_100723038 3300005439 Bacteria 840
17 Ga0070700_100057354 3300005441 Bacteria 2444
18 Ga0070663_101416301 3300005455 Bacteria 616
19 Ga0070678_100000345 3300005456 Bacteria 21680
20 Ga0070685_11467428 3300005466 Bacteria 525
21 Ga0070684_101158396 3300005535 Bacteria 727
22 Ga0070684_101419250 3300005535 Bacteria 654
23 Ga0068853_100243460 3300005539 Bacteria 1649
24 Ga0070686_100426617 3300005544 Bacteria 1014
25 Ga0070664_100274553 3300005564 Bacteria 1519
26 Ga0068856_100008235 3300005614 Bacteria 10164
27 Ga0070702_101189252 3300005615 Bacteria 614
28 Ga0068852_100184110 3300005616 Bacteria 1966
29 Ga0068861_100089527 3300005719 Bacteria 2426
30 Ga0068863_100018012 3300005841 Bacteria 6761
31 Ga0068858_100000097 3300005842 Bacteria 91503
32 Ga0068871_100136055 3300006358 Bacteria 2087
33 Ga0105240_11376979 3300009093 Bacteria 742
34 Ga0105245_10000143 3300009098 Bacteria 67618
35 Ga0105245_10031860 3300009098 Bacteria 4668
36 Ga0105245_10608051 3300009098 Bacteria 1120
37 Ga0105243_10004858 3300009148 Bacteria 10553
38 Ga0105242_10002124 3300009176 Bacteria 15632
39 Ga0105248_10440458 3300009177 Bacteria 1468
40 Ga0105239_10794834 3300010375 Bacteria 1084
41 Ga0157371_10006387 3300013102 Bacteria 9739
42 Ga0157370_10065778 3300013104 Bacteria 3429
43 Ga0157370_10067414 3300013104 Bacteria 3383
44 Ga0157370_11219955 3300013104 Bacteria 678
45 Ga0157369_11647595 3300013105 Bacteria 652
46 Ga0157374_10002572 3300013296 Bacteria 15292
47 Ga0157374_11237274 3300013296 Bacteria 768
48 Ga0157378_10020559 3300013297 Bacteria 5804
49 Ga0157372_10000330 3300013307 Bacteria 51965
50 Ga0157372_10832720 3300013307 Bacteria 1071
51 Ga0157375_10000127 3300013308 Bacteria 75142
52 Ga0157375_13591121 3300013308 Bacteria 516
53 Ga0163163_10656317 3300014325 Bacteria 1112
54 Ga0163163_11154237 3300014325 Unclassified 837
55 Ga0157380_10262010 3300014326 Bacteria 1571
56 Ga0163161_10167699 3300017792 Bacteria 1677
57 Ga0207695_11301760 3300025913 Bacteria 607
58 Ga0207663_10062522 3300025916 Bacteria 2367
59 Ga0207663_11278100 3300025916 Bacteria 591
60 Ga0207662_10615494 3300025918 Bacteria 756
61 Ga0207649_10000028 3300025920 Bacteria 161482
62 Ga0207659_10000022 3300025926 Bacteria 143432
63 Ga0207687_10000020 3300025927 Bacteria 228407
64 Ga0207687_10016084 3300025927 Bacteria 4910
65 Ga0207700_10000007 3300025928 Bacteria 345720
66 Ga0207664_10149511 3300025929 Bacteria 1983
67 Ga0207686_10000061 3300025934 Bacteria 97978
68 Ga0207686_10099605 3300025934 Bacteria 1938
69 Ga0207709_10004275 3300025935 Bacteria 8269
70 Ga0207669_11638789 3300025937 Bacteria 549
71 Ga0207711_10310078 3300025941 Bacteria 1457
72 Ga0207712_10000019 3300025961 Bacteria 317060
73 Ga0207668_10052045 3300025972 Bacteria 2832
74 Ga0207658_10156081 3300025986 Bacteria 1865
75 Ga0207658_10241621 3300025986 Bacteria 1530
76 Ga0207658_11774826 3300025986 Bacteria 563
77 Ga0207677_10000299 3300026023 Bacteria 37042
78 Ga0207677_10000588 3300026023 Bacteria 22552
79 Ga0207703_10000103 3300026035 Bacteria 99918
80 Ga0207639_10271296 3300026041 Bacteria 1488
81 Ga0207678_11031142 3300026067 Bacteria 728
82 Ga0207708_10091553 3300026075 Bacteria 2345
83 Ga0207708_10968183 3300026075 Bacteria 738
84 Ga0207702_10000930 3300026078 Bacteria 30180
85 Ga0207641_10013259 3300026088 Bacteria 6760
86 Ga0207675_100142579 3300026118 Bacteria 2277
87 Ga0207683_10001994 3300026121 Bacteria 18063
88 Ga0207698_10368259 3300026142 Bacteria 1363
89 Ga0307415_100000494 3300032126 Bacteria 17107
90 Ga0373953_0562207 3300035117 Unclassified 507
91 Ga0373957_0074574 3300035120 Bacteria 1332
92 Ga0373955_0348238 3300035172 Bacteria 897
93 Ga0373924_0576767 3300035410 Unclassified 507
94 Ga0373933_0770593 3300035724 Unclassified 633
95 Ga0373937_0039596 3300036401 Bacteria 4295
96 Ga0373937_0057238 3300036401 Bacteria 3581
97 Ga0451800_0087821 3300041459 Bacteria 538
98 Ga0451802_0684020 3300041460 Bacteria 658
99 Ga0451807_0571058 3300041486 Bacteria 1055
100 Ga0451807_1208069 3300041486 Bacteria 844
101 Ga0451845_0321970 3300041501 Bacteria 1494
102 Ga0451847_0723208 3300041503 Bacteria 643
103 Ga0451853_1342871 3300041512 Bacteria 1116
104 Ga0466957_0007409 3300044842 Bacteria 6201
105 Ga0466957_0134216 3300044842 Bacteria 1589
106 Ga0466967_0058626 3300045976 Bacteria 3404
107 Ga0495592_0000318 3300046454 Bacteria 40338
108 Ga0495592_0086700 3300046454 Bacteria 2254
109 Ga0495603_0000613 3300046455 Bacteria 20015
110 Ga0495629_0003258 3300046459 Bacteria 12287
111 Ga0495641_0067388 3300046461 Bacteria 1610
112 Ga0495651_0112990 3300046462 Bacteria 2006
113 Ga0495651_0838231 3300046462 Unclassified 565
114 Ga0495585_0286448 3300046492 Bacteria 813
115 Ga0495608_0014216 3300046511 Bacteria 5523
116 Ga0495608_0290043 3300046511 Bacteria 1014
117 Ga0495618_0000144 3300046514 Bacteria 50904
118 Ga0495618_0086452 3300046514 Bacteria 2005
119 Ga0495628_0003987 3300046516 Bacteria 13155
120 Ga0495628_0131320 3300046516 Bacteria 1915
121 Ga0495628_0891229 3300046516 Bacteria 618
122 Ga0495652_0526470 3300046529 Bacteria 816
123 Ga0495587_0002973 3300046536 Bacteria 11335
124 Ga0495621_0000468 3300046539 Bacteria 9918
125 Ga0495656_0000431 3300046615 Bacteria 13650
126 Ga0495634_0000031 3300046642 Bacteria 110396
127 Ga0495625_0000453 3300046660 Bacteria 61379
128 Ga0495623_0593916 3300046679 Unclassified 576
129 Ga0495646_0681916 3300046680 Unclassified 518
130 Ga0495647_0000009 3300046681 Bacteria 94874
131 Ga0495647_0091520 3300046681 Bacteria 1248
132 Ga0495600_0000645 3300046809 Bacteria 18030
133 Ga0495600_0012226 3300046809 Bacteria 5362
134 Ga0495600_0472191 3300046809 Bacteria 774
135 Ga0495604_0386715 3300047317 Bacteria 923
136 Ga0495674_1325335 3300047319 Unclassified 539
137 Ga0495672_0035559 3300047320 Bacteria 3068
138 Ga0495672_0258335 3300047320 Bacteria 842
139 Ga0495676_0002336 3300047321 Bacteria 16808
140 Ga0495676_0052307 3300047321 Bacteria 3261
141 Ga0496102_0000081 3300048905 Bacteria 139266
142 Ga0496103_0000031 3300048906 Bacteria 204016
143 Ga0496104_0156062 3300048907 Bacteria 2190
144 Ga0496105_0001296 3300048908 Bacteria 17493
145 Ga0496108_0000055 3300048911 Bacteria 125202
146 Ga0496108_0011042 3300048911 Bacteria 7334
147 Ga0496109_0000043 3300048912 Bacteria 134649
148 Ga0496109_0000628 3300048912 Bacteria 29413
149 Ga0496109_1646420 3300048912 Bacteria 576
150 Ga0496113_0003087 3300048916 Bacteria 9895
151 Ga0496114_0198607 3300048917 Bacteria 1756
152 Ga0496115_0011758 3300048918 Bacteria 6574
153 Ga0496118_0195427 3300048921 Bacteria 1205
154 Ga0501042_0121279 3300049578 Bacteria 1882
155 Ga0501042_0174074 3300049578 Bacteria 1553
156 Ga0501070_0214051 3300049586 Bacteria 1581
157 Ga0501076_0034104 3300049592 Bacteria 3977
158 Ga0501079_0736736 3300049741 Bacteria 776
159 Ga0495601_0513538 3300053077 Bacteria 772
160 Ga0495601_1032965 3300053077 Unclassified 516
161 Ga0495595_0046044 3300053084 Bacteria 2008
162 Ga0495595_0272858 3300053084 Unclassified 848
163 Ga0495619_0000010 3300053085 Bacteria 302390
164 Ga0495619_0311994 3300053085 Bacteria 1089

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014326 Ga0157380_10262010 Ga0157380_102620102 37
2 3300005338 Ga0068868_100000225 Ga0068868_10000022533 42
3 3300026023 Ga0207677_10000299 Ga0207677_100002995 42
4 3300048911 Ga0496108_0011042 Ga0496108_0011042_884_1039 42
5 3300048912 Ga0496109_0000628 Ga0496109_0000628_18783_18938 42
6 3300048917 Ga0496114_0198607 Ga0496114_0198607_358_510 42
7 3300048918 Ga0496115_0011758 Ga0496115_0011758_4807_4959 42
8 3300005436 Ga0070713_100000054 Ga0070713_1000000542 43
9 3300013307 Ga0157372_10832720 Ga0157372_108327202 43
10 3300013308 Ga0157375_13591121 Ga0157375_135911211 43
11 3300025928 Ga0207700_10000007 Ga0207700_10000007200 43
12 3300049741 Ga0501079_0736736 Ga0501079_0736736_203_355 44
13 3300013104 Ga0157370_11219955 Ga0157370_112199552 45
14 3300046660 Ga0495625_0000453 Ga0495625_0000453_27266_27418 45
15 3300046454 Ga0495592_0086700 Ga0495592_0086700_927_1073 46
16 3300046462 Ga0495651_0838231 Ga0495651_0838231_348_494 46
17 3300046809 Ga0495600_0472191 Ga0495600_0472191_539_685 46
18 3300053084 Ga0495595_0272858 Ga0495595_0272858_277_423 46
19 3300005329 Ga0070683_100318534 Ga0070683_1003185342 48
20 3300005535 Ga0070684_101419250 Ga0070684_1014192502 48
21 3300005564 Ga0070664_100274553 Ga0070664_1002745532 48
22 3300009176 Ga0105242_10002124 Ga0105242_100021247 48
23 3300025934 Ga0207686_10000061 Ga0207686_1000006194 48
24 3300000546 LJNas_1008695 LJNas_10086952 50
25 3300002459 JGI24751J29686_10032552 JGI24751J29686_100325522 50
26 3300005337 Ga0070682_100267300 Ga0070682_1002673002 50
27 3300005338 Ga0068868_100000520 Ga0068868_1000005209 50
28 3300005341 Ga0070691_10000708 Ga0070691_100007084 50
29 3300005344 Ga0070661_100000035 Ga0070661_10000003565 50
30 3300005347 Ga0070668_100095815 Ga0070668_1000958152 50
31 3300005367 Ga0070667_100189292 Ga0070667_1001892922 50
32 3300005367 Ga0070667_100588582 Ga0070667_1005885822 50
33 3300005435 Ga0070714_100509800 Ga0070714_1005098002 50
34 3300005438 Ga0070701_10362953 Ga0070701_103629532 50
35 3300005439 Ga0070711_100032920 Ga0070711_1000329202 50
36 3300005439 Ga0070711_100723038 Ga0070711_1007230382 50
37 3300005441 Ga0070700_100057354 Ga0070700_1000573543 50
38 3300005455 Ga0070663_101416301 Ga0070663_1014163012 50
39 3300005456 Ga0070678_100000345 Ga0070678_10000034516 50
40 3300005466 Ga0070685_11467428 Ga0070685_114674281 50
41 3300005535 Ga0070684_101158396 Ga0070684_1011583962 50
42 3300005539 Ga0068853_100243460 Ga0068853_1002434602 50
43 3300005544 Ga0070686_100426617 Ga0070686_1004266171 50
44 3300005614 Ga0068856_100008235 Ga0068856_1000082356 50
45 3300005615 Ga0070702_101189252 Ga0070702_1011892521 50
46 3300005616 Ga0068852_100184110 Ga0068852_1001841103 50
47 3300005719 Ga0068861_100089527 Ga0068861_1000895273 50
48 3300005841 Ga0068863_100018012 Ga0068863_1000180123 50
49 3300005842 Ga0068858_100000097 Ga0068858_10000009776 50
50 3300006358 Ga0068871_100136055 Ga0068871_1001360552 50
51 3300009093 Ga0105240_11376979 Ga0105240_113769792 50
52 3300009098 Ga0105245_10000143 Ga0105245_1000014370 50
53 3300009098 Ga0105245_10031860 Ga0105245_100318602 50
54 3300009098 Ga0105245_10608051 Ga0105245_106080512 50
55 3300009148 Ga0105243_10004858 Ga0105243_100048589 50
56 3300009177 Ga0105248_10440458 Ga0105248_104404582 50
57 3300010375 Ga0105239_10794834 Ga0105239_107948342 50
58 3300013102 Ga0157371_10006387 Ga0157371_100063876 50
59 3300013104 Ga0157370_10065778 Ga0157370_100657785 50
60 3300013104 Ga0157370_10067414 Ga0157370_100674144 50
61 3300013105 Ga0157369_11647595 Ga0157369_116475952 50
62 3300013296 Ga0157374_10002572 Ga0157374_1000257215 50
63 3300013296 Ga0157374_11237274 Ga0157374_112372742 50
64 3300013297 Ga0157378_10020559 Ga0157378_100205593 50
65 3300013307 Ga0157372_10000330 Ga0157372_1000033059 50
66 3300013308 Ga0157375_10000127 Ga0157375_1000012733 50
67 3300014325 Ga0163163_10656317 Ga0163163_106563172 50
68 3300014325 Ga0163163_11154237 Ga0163163_111542372 50
69 3300017792 Ga0163161_10167699 Ga0163161_101676992 50
70 3300025913 Ga0207695_11301760 Ga0207695_113017602 50
71 3300025916 Ga0207663_10062522 Ga0207663_100625222 50
72 3300025916 Ga0207663_11278100 Ga0207663_112781002 50
73 3300025918 Ga0207662_10615494 Ga0207662_106154942 50
74 3300025920 Ga0207649_10000028 Ga0207649_1000002897 50
75 3300025926 Ga0207659_10000022 Ga0207659_10000022118 50
76 3300025927 Ga0207687_10000020 Ga0207687_1000002070 50
77 3300025927 Ga0207687_10016084 Ga0207687_100160844 50
78 3300025929 Ga0207664_10149511 Ga0207664_101495112 50
79 3300025934 Ga0207686_10099605 Ga0207686_100996052 50
80 3300025935 Ga0207709_10004275 Ga0207709_100042755 50
81 3300025937 Ga0207669_11638789 Ga0207669_116387891 50
82 3300025941 Ga0207711_10310078 Ga0207711_103100782 50
83 3300025961 Ga0207712_10000019 Ga0207712_10000019240 50
84 3300025972 Ga0207668_10052045 Ga0207668_100520453 50
85 3300025986 Ga0207658_10156081 Ga0207658_101560812 50
86 3300025986 Ga0207658_10241621 Ga0207658_102416212 50
87 3300025986 Ga0207658_11774826 Ga0207658_117748261 50
88 3300026023 Ga0207677_10000588 Ga0207677_1000058815 50
89 3300026035 Ga0207703_10000103 Ga0207703_1000010387 50
90 3300026041 Ga0207639_10271296 Ga0207639_102712962 50
91 3300026067 Ga0207678_11031142 Ga0207678_110311422 50
92 3300026075 Ga0207708_10091553 Ga0207708_100915533 50
93 3300026075 Ga0207708_10968183 Ga0207708_109681832 50
94 3300026078 Ga0207702_10000930 Ga0207702_100009306 50
95 3300026088 Ga0207641_10013259 Ga0207641_100132593 50
96 3300026118 Ga0207675_100142579 Ga0207675_1001425792 50
97 3300026121 Ga0207683_10001994 Ga0207683_100019946 50
98 3300026142 Ga0207698_10368259 Ga0207698_103682592 50
99 3300032126 Ga0307415_100000494 Ga0307415_10000049414 50
100 3300035117 Ga0373953_0562207 Ga0373953_0562207_111_266 50
101 3300035120 Ga0373957_0074574 Ga0373957_0074574_718_873 50
102 3300035172 Ga0373955_0348238 Ga0373955_0348238_343_498 50
103 3300035410 Ga0373924_0576767 Ga0373924_0576767_181_336 50
104 3300035724 Ga0373933_0770593 Ga0373933_0770593_221_376 50
105 3300036401 Ga0373937_0039596 Ga0373937_0039596_3221_3376 50
106 3300036401 Ga0373937_0057238 Ga0373937_0057238_2707_2862 50
107 3300041459 Ga0451800_0087821 Ga0451800_0087821_257_409 50
108 3300041460 Ga0451802_0684020 Ga0451802_0684020_475_627 50
109 3300041486 Ga0451807_0571058 Ga0451807_0571058_282_434 50
110 3300041486 Ga0451807_1208069 Ga0451807_1208069_368_523 50
111 3300041501 Ga0451845_0321970 Ga0451845_0321970_37_189 50
112 3300041503 Ga0451847_0723208 Ga0451847_0723208_34_186 50
113 3300041512 Ga0451853_1342871 Ga0451853_1342871_669_821 50
114 3300044842 Ga0466957_0007409 Ga0466957_0007409_2183_2335 50
115 3300044842 Ga0466957_0134216 Ga0466957_0134216_813_965 50
116 3300045976 Ga0466967_0058626 Ga0466967_0058626_1183_1341 50
117 3300046454 Ga0495592_0000318 Ga0495592_0000318_25448_25603 50
118 3300046455 Ga0495603_0000613 Ga0495603_0000613_7800_7955 50
119 3300046459 Ga0495629_0003258 Ga0495629_0003258_9263_9415 50
120 3300046461 Ga0495641_0067388 Ga0495641_0067388_1179_1331 50
121 3300046462 Ga0495651_0112990 Ga0495651_0112990_1334_1486 50
122 3300046492 Ga0495585_0286448 Ga0495585_0286448_221_376 50
123 3300046511 Ga0495608_0014216 Ga0495608_0014216_5026_5178 50
124 3300046511 Ga0495608_0290043 Ga0495608_0290043_803_958 50
125 3300046514 Ga0495618_0000144 Ga0495618_0000144_36348_36503 50
126 3300046514 Ga0495618_0086452 Ga0495618_0086452_1764_1916 50
127 3300046516 Ga0495628_0003987 Ga0495628_0003987_4420_4575 50
128 3300046516 Ga0495628_0131320 Ga0495628_0131320_788_940 50
129 3300046516 Ga0495628_0891229 Ga0495628_0891229_31_183 50
130 3300046529 Ga0495652_0526470 Ga0495652_0526470_187_339 50
131 3300046536 Ga0495587_0002973 Ga0495587_0002973_3460_3612 50
132 3300046539 Ga0495621_0000468 Ga0495621_0000468_9064_9219 50
133 3300046615 Ga0495656_0000431 Ga0495656_0000431_3053_3208 50
134 3300046642 Ga0495634_0000031 Ga0495634_0000031_37389_37541 50
135 3300046679 Ga0495623_0593916 Ga0495623_0593916_52_204 50
136 3300046680 Ga0495646_0681916 Ga0495646_0681916_163_315 50
137 3300046681 Ga0495647_0000009 Ga0495647_0000009_35236_35391 50
138 3300046681 Ga0495647_0091520 Ga0495647_0091520_261_416 50
139 3300046809 Ga0495600_0000645 Ga0495600_0000645_11240_11395 50
140 3300046809 Ga0495600_0012226 Ga0495600_0012226_829_984 50
141 3300047317 Ga0495604_0386715 Ga0495604_0386715_75_230 50
142 3300047319 Ga0495674_1325335 Ga0495674_1325335_262_417 50
143 3300047320 Ga0495672_0035559 Ga0495672_0035559_2174_2329 50
144 3300047320 Ga0495672_0258335 Ga0495672_0258335_47_202 50
145 3300047321 Ga0495676_0002336 Ga0495676_0002336_12793_12948 50
146 3300047321 Ga0495676_0052307 Ga0495676_0052307_2292_2444 50
147 3300048905 Ga0496102_0000081 Ga0496102_0000081_64329_64481 50
148 3300048906 Ga0496103_0000031 Ga0496103_0000031_73863_74015 50
149 3300048907 Ga0496104_0156062 Ga0496104_0156062_1439_1591 50
150 3300048908 Ga0496105_0001296 Ga0496105_0001296_16713_16865 50
151 3300048911 Ga0496108_0000055 Ga0496108_0000055_112041_112193 50
152 3300048912 Ga0496109_0000043 Ga0496109_0000043_117416_117568 50
153 3300048912 Ga0496109_1646420 Ga0496109_1646420_225_377 50
154 3300048916 Ga0496113_0003087 Ga0496113_0003087_2971_3126 50
155 3300048921 Ga0496118_0195427 Ga0496118_0195427_736_888 50
156 3300049578 Ga0501042_0121279 Ga0501042_0121279_260_412 50
157 3300049578 Ga0501042_0174074 Ga0501042_0174074_1066_1218 50
158 3300049586 Ga0501070_0214051 Ga0501070_0214051_517_669 50
159 3300049592 Ga0501076_0034104 Ga0501076_0034104_3701_3853 50
160 3300053077 Ga0495601_0513538 Ga0495601_0513538_474_626 50
161 3300053077 Ga0495601_1032965 Ga0495601_1032965_122_277 50
162 3300053084 Ga0495595_0046044 Ga0495595_0046044_1782_1937 50
163 3300053085 Ga0495619_0000010 Ga0495619_0000010_82040_82192 50
164 3300053085 Ga0495619_0311994 Ga0495619_0311994_780_935 50

Feature Viewer

pLDDT pTM Quality
80.76 0.43 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map