F242732

General Info

Members Datasets Scaffolds Average Seq Length
163 137 129 257

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2738543013|2739248081
Length 294
Sequence GAECRVRATAGKAFHFKAPDNPSMLFLLSPAKSLDYESPISAELPATTPHFESPRGPSVELIRVLRQKSPQQISELMDLSDKLSLLNVGRYADWRAKSTPENSRQAALAFDGDVYGGLDAKTLTGAQLDWAQEHVVILSGLYGVLRPLDRLQPYRLEMGTQLATPRGNNLYDFWGSRISDYLNKRAAADATPVVINLASQEYFRAVDLKALKARVVECVFEEWKPQPGKAAKSGEGQYKIISFFAKRARGLMARWAVLHKAATPKALERFDLEGYAFDAAVSRPDRMVFRRKSP

Samples

Sample ID Description Type Environment
1 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
2 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
3 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
4 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
5 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
6 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
7 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
8 2636415599 Klebsiella variicola DX120E Isolate Unclassified
9 2643221569 Achromobacter sp. Root565 Isolate Unclassified
10 2643221594 Achromobacter sp. Root170 Isolate Unclassified
11 2643221621 Achromobacter sp. Root83 Isolate Unclassified
12 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified
13 2738543013 Variovorax sp. BT01 Isolate Unclassified
14 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
15 2775507074 Klebsiella sp. D5A Isolate Unclassified
16 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
17 2821118458 Enterobacter asburiae 609 Isolate Unclassified
18 2857553236 Duganella sp. R-74557 Isolate Unclassified
19 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
20 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
21 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
22 2919476304 Duganella sp. 3397 Isolate Unclassified
23 2937539931 Pantoea sp. LS15 Isolate Unclassified
24 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
25 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
26 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
27 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
28 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
29 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
30 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
31 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
32 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
33 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
34 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
35 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
36 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
40 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
41 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
48 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
49 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
50 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
51 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
52 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
59 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
60 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
61 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
62 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
63 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
64 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
65 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
66 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
67 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
68 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
69 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
70 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
71 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
72 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
73 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
74 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
75 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
76 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
77 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
78 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
79 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
80 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
81 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
82 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
83 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
84 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
85 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
86 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
87 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
88 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
89 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
90 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
91 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
92 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
93 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
94 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
95 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
96 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
97 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
98 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
99 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
100 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
101 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
102 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
103 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
104 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
105 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
106 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
107 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
108 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
109 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
110 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
111 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
112 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
113 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
114 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
115 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
116 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
117 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
118 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
119 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
120 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
127 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
128 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
131 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
132 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
133 639633007 Azoarcus olearius BH72 Isolate Unclassified
134 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
135 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
136 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
137 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.14
Metatranscriptomes 0
Isolates 20.86

Biome Distribution

Category Percentage (%)
Aerial Root 1.23
Bulb 0
Endosphere 4.29
Nodule 1.23
Rhizoplane 4.29
Rhizosphere 68.71
Stem 0
Stem Tuber 0
Unclassified 20.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10069253 3300003316 Bacteria 2490
2 rootL2_10092270 3300003322 Bacteria 3297
3 rootH1_10048146 3300003323 Bacteria 2651
4 Ga0055534_1006930 3300003784 Bacteria 2782
5 Ga0058692_1011835 3300003856 Bacteria 2092
6 Ga0058692_1018883 3300003856 Bacteria 1481
7 Ga0065165_1000243 3300005262 Bacteria 93455
8 Ga0065704_10072193 3300005289 Bacteria 8972
9 Ga0065704_10077224 3300005289 Bacteria 4797
10 Ga0070667_100109976 3300005367 Bacteria 2389
11 Ga0068851_10208999 3300005834 Bacteria 1092
12 Ga0079104_1000629 3300006946 Bacteria 34402
13 Ga0105251_10006521 3300009011 Bacteria 7409
14 Ga0105250_10000045 3300009092 Bacteria 127333
15 Ga0105240_10002809 3300009093 Bacteria 27496
16 Ga0105237_10002917 3300009545 Bacteria 20717
17 Ga0105238_10081428 3300009551 Bacteria 3227
18 Ga0105239_10001353 3300010375 Bacteria 32991
19 Ga0157371_10000026 3300013102 Bacteria 274703
20 Ga0182008_10005354 3300014497 Bacteria 7327
21 Ga0182006_1000042 3300015261 Bacteria 202969
22 Ga0182007_10006071 3300015262 Bacteria 5222
23 Ga0182005_1000008 3300015265 Bacteria 471394
24 Ga0209130_1010964 3300025284 Bacteria 2456
25 Ga0209675_1006624 3300025291 Bacteria 4608
26 Ga0209257_1012550 3300025304 Bacteria 3899
27 Ga0207695_10005251 3300025913 Bacteria 17291
28 Ga0207671_10001552 3300025914 Bacteria 26284
29 Ga0207694_10055362 3300025924 Bacteria 3079
30 Ga0207683_10096234 3300026121 Bacteria 2640
31 Ga0209371_1006480 3300027312 Bacteria 4325
32 Ga0209371_1008296 3300027312 Bacteria 3477
33 Ga0268256_1008796 3300030500 Bacteria 3428
34 Ga0316177_1187518 3300030731 Bacteria 1553
35 Ga0265328_10004970 3300031239 Bacteria 5729
36 Ga0265331_10006818 3300031250 Bacteria 6692
37 Ga0265327_10000078 3300031251 Bacteria 207398
38 Ga0265327_10030300 3300031251 Bacteria 3061
39 Ga0307408_100131581 3300031548 Bacteria 1952
40 Ga0307405_10230325 3300031731 Bacteria 1365
41 Ga0307412_10281709 3300031911 Bacteria 1305
42 Ga0307416_100028625 3300032002 Bacteria 4147
43 Ga0395899_0000012 3300037312 Bacteria 517561
44 Ga0395899_0001610 3300037312 Bacteria 18879
45 Ga0439436_0016262 3300041404 Bacteria 2232
46 Ga0439439_0000835 3300041406 Bacteria 5630
47 Ga0439466_0015032 3300041411 Bacteria 2813
48 Ga0439431_0040121 3300041997 Bacteria 1189
49 Ga0439433_0007710 3300041999 Bacteria 2327
50 Ga0439449_0072541 3300042007 Bacteria 1268
51 Ga0439452_003585 3300042010 Bacteria 5408
52 Ga0439457_003232 3300042014 Bacteria 4478
53 Ga0439462_0002413 3300042015 Bacteria 4339
54 Ga0439446_0003226 3300042156 Bacteria 4025
55 Ga0450908_003873 3300042184 Bacteria 2898
56 Ga0451577_0011507 3300042876 Bacteria 8361
57 Ga0466970_0005011 3300044765 Bacteria 6545
58 Ga0466957_0034647 3300044842 Bacteria 3028
59 Ga0495617_000060 3300046452 Bacteria 97123
60 Ga0495638_0011058 3300046460 Bacteria 6237
61 Ga0495605_0124208 3300046474 Bacteria 1168
62 Ga0495639_0060271 3300046475 Bacteria 1738
63 Ga0495584_0000001 3300046491 Bacteria 649329
64 Ga0495584_0052707 3300046491 Bacteria 2047
65 Ga0495585_0000011 3300046492 Bacteria 210440
66 Ga0495585_0008316 3300046492 Bacteria 6295
67 Ga0495585_0026125 3300046492 Bacteria 3337
68 Ga0495585_0028531 3300046492 Bacteria 3183
69 Ga0495585_0124319 3300046492 Bacteria 1362
70 Ga0495607_0007655 3300046501 Bacteria 7442
71 Ga0495607_0051280 3300046501 Bacteria 2397
72 Ga0495583_0031092 3300046506 Bacteria 2592
73 Ga0495631_0011176 3300046518 Bacteria 4423
74 Ga0495632_0215622 3300046519 Bacteria 869
75 Ga0495643_0023773 3300046522 Bacteria 3480
76 Ga0495644_0075457 3300046523 Bacteria 1269
77 Ga0495642_0011859 3300046528 Bacteria 3358
78 Ga0495642_0030165 3300046528 Bacteria 2168
79 Ga0495609_0082312 3300046538 Bacteria 1406
80 Ga0495597_0059885 3300046542 Bacteria 1661
81 Ga0495597_0110855 3300046542 Bacteria 1150
82 Ga0495633_0086663 3300046558 Bacteria 1456
83 Ga0495656_0006431 3300046615 Bacteria 4123
84 Ga0495668_0010357 3300046616 Bacteria 5645
85 Ga0495668_0032259 3300046616 Bacteria 2949
86 Ga0495668_0037221 3300046616 Bacteria 2722
87 Ga0495668_0068983 3300046616 Bacteria 1944
88 Ga0495611_0013502 3300046648 Bacteria 3478
89 Ga0495659_0168306 3300046664 Bacteria 888
90 Ga0495661_0008697 3300046665 Bacteria 7013
91 Ga0495661_0045832 3300046665 Bacteria 2671
92 Ga0495661_0194154 3300046665 Bacteria 1067
93 Ga0495670_0056008 3300046691 Bacteria 1977
94 Ga0495670_0103603 3300046691 Bacteria 1467
95 Ga0495671_0006287 3300046692 Bacteria 6873
96 Ga0495589_0052311 3300046794 Bacteria 2018
97 Ga0495683_0072926 3300047323 Bacteria 1684
98 Ga0495677_0016658 3300047445 Bacteria 2667
99 Ga0495677_0044940 3300047445 Bacteria 1619
100 Ga0495685_014405 3300047447 Bacteria 2687
101 Ga0496102_0063894 3300048905 Bacteria 3371
102 Ga0496112_0219431 3300048915 Bacteria 1858
103 Ga0496116_0001156 3300048919 Bacteria 31157
104 Ga0496116_0030023 3300048919 Bacteria 3911
105 Ga0496117_0017883 3300048920 Bacteria 5906
106 Ga0496118_0022847 3300048921 Bacteria 5453
107 Ga0496119_0000031 3300048922 Bacteria 239685
108 Ga0496119_0007715 3300048922 Bacteria 9621
109 Ga0496119_0121622 3300048922 Bacteria 1434
110 Ga0496120_0000017 3300048923 Bacteria 269222
111 Ga0496120_0002535 3300048923 Bacteria 18240
112 Ga0496121_0029034 3300048924 Bacteria 5130
113 Ga0496124_0000528 3300048927 Bacteria 65079
114 Ga0496125_0063835 3300048928 Bacteria 2933
115 Ga0501032_0175906 3300049569 Bacteria 1402
116 Ga0501037_0089909 3300049573 Bacteria 2222
117 Ga0501043_0000112 3300049579 Bacteria 76249
118 Ga0501046_0000146 3300049580 Bacteria 74204
119 Ga0501047_0000192 3300049581 Bacteria 74300
120 Ga0501047_0234756 3300049581 Bacteria 1686
121 Ga0501048_0010903 3300049582 Bacteria 6778
122 Ga0501280_000116 3300049776 Bacteria 21015
123 Ga0501282_003334 3300049778 Bacteria 1731
124 Ga0501044_0007580 3300049823 Bacteria 11931
125 Ga0501044_0280490 3300049823 Bacteria 1600
126 Ga0501045_0002598 3300049824 Bacteria 12321
127 Ga0501226_001056 3300049853 Bacteria 3557
128 nmdc:mga0k408_97_c1 3300050493 Bacteria 42090
129 Ga0500608_119553 3300053122 Unclassified 1197

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031251 Ga0265327_10030300 Ga0265327_100303002 224
2 3300014497 Ga0182008_10005354 Ga0182008_100053545 236
3 3300015262 Ga0182007_10006071 Ga0182007_100060713 236
4 3300046475 Ga0495639_0060271 Ga0495639_0060271_481_1290 236
5 3300048922 Ga0496119_0000031 Ga0496119_0000031_109654_110424 237
6 3300048923 Ga0496120_0000017 Ga0496120_0000017_214023_214793 237
7 3300003856 Ga0058692_1011835 Ga0058692_10118352 241
8 3300027312 Ga0209371_1006480 Ga0209371_10064803 241
9 3300030500 Ga0268256_1008796 Ga0268256_10087962 241
10 3300049853 Ga0501226_001056 Ga0501226_001056_1222_1956 244
11 3300048919 Ga0496116_0001156 Ga0496116_0001156_25998_26774 247
12 3300048922 Ga0496119_0007715 Ga0496119_0007715_1817_2593 247
13 3300048923 Ga0496120_0002535 Ga0496120_0002535_4312_5088 247
14 3300046501 Ga0495607_0007655 Ga0495607_0007655_5711_6460 248
15 iso_pu_bacteria 2857553236 2857557381 252
16 iso_pu_bacteria 2919476304 2919478025 252
17 iso_pu_bacteria 2599185292 2599907183 253
18 iso_pu_bacteria 2602042047 2603644602 253
19 iso_pu_bacteria 2602042067 2603705933 253
20 iso_pu_bacteria 2602042109 2603868518 253
21 iso_pu_bacteria 2609459761 2609911983 253
22 iso_pu_bacteria 2636415599 2637227166 253
23 iso_pu_bacteria 2643221569 2643862493 253
24 iso_pu_bacteria 2643221594 2643980495 253
25 iso_pu_bacteria 2643221621 2644124797 253
26 iso_pu_bacteria 2775506706 2775540811 253
27 iso_pu_bacteria 2775507074 2777021564 253
28 iso_pu_bacteria 2808606395 2809032188 253
29 iso_pu_bacteria 2821118458 2821121425 253
30 iso_pu_bacteria 2888373701 2888375091 253
31 iso_pu_bacteria 2904513164 2904516111 253
32 iso_pu_bacteria 2937539931 2937540082 253
33 iso_pu_bacteria 2945874760 2945879808 253
34 iso_pu_bacteria 2969079654 2969084180 253
35 iso_pu_bacteria 2978975091 2978976806 253
36 iso_pu_bacteria 2984559226 2984561259 253
37 iso_pu_bacteria 2984595703 2984599330 253
38 iso_pu_bacteria 3000376612 3000380544 253
39 iso_pu_bacteria 639633007 639787035 253
40 iso_pu_bacteria 8002745576 8002746510 253
41 iso_pu_bacteria 8054844752 8054848643 253
42 iso_pu_bacteria 8055087960 8055092615 253
43 iso_pu_bacteria 8057304971 8057307366 253
44 iso_pu_bacteria 2526164512 2526211082 254
45 iso_pu_bacteria 2551306416 2553003687 254
46 3300046492 Ga0495585_0124319 Ga0495585_0124319_537_1304 255
47 3300046665 Ga0495661_0008697 Ga0495661_0008697_494_1261 255
48 3300048905 Ga0496102_0063894 Ga0496102_0063894_583_1350 255
49 iso_pu_bacteria 2734482258 2735817364 255
50 iso_pu_bacteria 2894023352 2894026957 255
51 3300005262 Ga0065165_1000243 Ga0065165_100024332 256
52 3300013102 Ga0157371_10000026 Ga0157371_1000002658 256
53 3300015261 Ga0182006_1000042 Ga0182006_1000042154 256
54 3300015265 Ga0182005_1000008 Ga0182005_1000008139 256
55 3300027312 Ga0209371_1008296 Ga0209371_10082962 256
56 3300030731 Ga0316177_1187518 Ga0316177_11875182 256
57 3300031239 Ga0265328_10004970 Ga0265328_100049704 256
58 3300031250 Ga0265331_10006818 Ga0265331_100068185 256
59 3300031251 Ga0265327_10000078 Ga0265327_1000007829 256
60 3300037312 Ga0395899_0000012 Ga0395899_0000012_121049_121819 256
61 3300044842 Ga0466957_0034647 Ga0466957_0034647_1658_2434 256
62 3300046452 Ga0495617_000060 Ga0495617_000060_47128_47898 256
63 3300046460 Ga0495638_0011058 Ga0495638_0011058_669_1439 256
64 3300046474 Ga0495605_0124208 Ga0495605_0124208_100_870 256
65 3300046491 Ga0495584_0000001 Ga0495584_0000001_295874_296644 256
66 3300046491 Ga0495584_0052707 Ga0495584_0052707_608_1378 256
67 3300046492 Ga0495585_0000011 Ga0495585_0000011_59684_60454 256
68 3300046492 Ga0495585_0008316 Ga0495585_0008316_3918_4688 256
69 3300046492 Ga0495585_0026125 Ga0495585_0026125_1079_1849 256
70 3300046492 Ga0495585_0028531 Ga0495585_0028531_409_1179 256
71 3300046501 Ga0495607_0051280 Ga0495607_0051280_17_787 256
72 3300046506 Ga0495583_0031092 Ga0495583_0031092_621_1391 256
73 3300046518 Ga0495631_0011176 Ga0495631_0011176_1891_2661 256
74 3300046519 Ga0495632_0215622 Ga0495632_0215622_79_849 256
75 3300046522 Ga0495643_0023773 Ga0495643_0023773_2124_2894 256
76 3300046523 Ga0495644_0075457 Ga0495644_0075457_435_1205 256
77 3300046528 Ga0495642_0011859 Ga0495642_0011859_1141_1911 256
78 3300046538 Ga0495609_0082312 Ga0495609_0082312_194_964 256
79 3300046542 Ga0495597_0059885 Ga0495597_0059885_265_1035 256
80 3300046542 Ga0495597_0110855 Ga0495597_0110855_209_979 256
81 3300046558 Ga0495633_0086663 Ga0495633_0086663_259_1029 256
82 3300046615 Ga0495656_0006431 Ga0495656_0006431_787_1557 256
83 3300046616 Ga0495668_0010357 Ga0495668_0010357_1773_2543 256
84 3300046616 Ga0495668_0032259 Ga0495668_0032259_263_1033 256
85 3300046616 Ga0495668_0037221 Ga0495668_0037221_1681_2451 256
86 3300046616 Ga0495668_0068983 Ga0495668_0068983_1048_1818 256
87 3300046648 Ga0495611_0013502 Ga0495611_0013502_1138_1908 256
88 3300046664 Ga0495659_0168306 Ga0495659_0168306_108_878 256
89 3300046665 Ga0495661_0045832 Ga0495661_0045832_1228_1998 256
90 3300046665 Ga0495661_0194154 Ga0495661_0194154_266_1036 256
91 3300046691 Ga0495670_0056008 Ga0495670_0056008_175_945 256
92 3300046691 Ga0495670_0103603 Ga0495670_0103603_71_841 256
93 3300046692 Ga0495671_0006287 Ga0495671_0006287_1661_2431 256
94 3300046794 Ga0495589_0052311 Ga0495589_0052311_1121_1891 256
95 3300047323 Ga0495683_0072926 Ga0495683_0072926_113_883 256
96 3300047445 Ga0495677_0016658 Ga0495677_0016658_564_1334 256
97 3300047445 Ga0495677_0044940 Ga0495677_0044940_722_1492 256
98 3300047447 Ga0495685_014405 Ga0495685_014405_1842_2612 256
99 3300048915 Ga0496112_0219431 Ga0496112_0219431_418_1188 256
100 3300048920 Ga0496117_0017883 Ga0496117_0017883_2943_3713 256
101 3300048921 Ga0496118_0022847 Ga0496118_0022847_2246_3016 256
102 3300048922 Ga0496119_0121622 Ga0496119_0121622_298_1068 256
103 3300048928 Ga0496125_0063835 Ga0496125_0063835_92_862 256
104 3300003322 rootL2_10092270 rootL2_100922704 257
105 3300003323 rootH1_10048146 rootH1_100481462 257
106 3300003784 Ga0055534_1006930 Ga0055534_10069302 257
107 3300003856 Ga0058692_1018883 Ga0058692_10188831 257
108 3300005289 Ga0065704_10072193 Ga0065704_100721932 257
109 3300005289 Ga0065704_10077224 Ga0065704_100772242 257
110 3300005367 Ga0070667_100109976 Ga0070667_1001099761 257
111 3300006946 Ga0079104_1000629 Ga0079104_100062933 257
112 3300009092 Ga0105250_10000045 Ga0105250_10000045126 257
113 3300025284 Ga0209130_1010964 Ga0209130_10109642 257
114 3300025291 Ga0209675_1006624 Ga0209675_10066243 257
115 3300025304 Ga0209257_1012550 Ga0209257_10125503 257
116 3300031548 Ga0307408_100131581 Ga0307408_1001315812 257
117 3300031731 Ga0307405_10230325 Ga0307405_102303252 257
118 3300031911 Ga0307412_10281709 Ga0307412_102817091 257
119 3300032002 Ga0307416_100028625 Ga0307416_1000286254 257
120 3300041404 Ga0439436_0016262 Ga0439436_0016262_627_1412 257
121 3300041406 Ga0439439_0000835 Ga0439439_0000835_3346_4131 257
122 3300041411 Ga0439466_0015032 Ga0439466_0015032_1605_2390 257
123 3300041997 Ga0439431_0040121 Ga0439431_0040121_295_1080 257
124 3300041999 Ga0439433_0007710 Ga0439433_0007710_39_824 257
125 3300042007 Ga0439449_0072541 Ga0439449_0072541_434_1219 257
126 3300042010 Ga0439452_003585 Ga0439452_003585_1624_2409 257
127 3300042014 Ga0439457_003232 Ga0439457_003232_1464_2249 257
128 3300042015 Ga0439462_0002413 Ga0439462_0002413_2194_2979 257
129 3300042156 Ga0439446_0003226 Ga0439446_0003226_1324_2109 257
130 3300042184 Ga0450908_003873 Ga0450908_003873_48_833 257
131 3300046528 Ga0495642_0030165 Ga0495642_0030165_355_1236 257
132 3300048924 Ga0496121_0029034 Ga0496121_0029034_4239_5012 257
133 3300048927 Ga0496124_0000528 Ga0496124_0000528_62156_62929 257
134 3300049573 Ga0501037_0089909 Ga0501037_0089909_1003_1788 257
135 3300049581 Ga0501047_0234756 Ga0501047_0234756_832_1605 257
136 3300049776 Ga0501280_000116 Ga0501280_000116_8892_9665 257
137 3300049778 Ga0501282_003334 Ga0501282_003334_863_1636 257
138 3300049823 Ga0501044_0007580 Ga0501044_0007580_11050_11823 257
139 3300049823 Ga0501044_0280490 Ga0501044_0280490_102_887 257
140 3300050493 nmdc:mga0k408_97_c1 nmdc:mga0k408_97_c1_24869_25645 257
141 3300053122 Ga0500608_119553 Ga0500608_119553_298_1077 257
142 iso_pu_bacteria 2738543013 2739248081 257
143 3300037312 Ga0395899_0001610 Ga0395899_0001610_2277_3053 258
144 3300042876 Ga0451577_0011507 Ga0451577_0011507_3980_4756 258
145 3300044765 Ga0466970_0005011 Ga0466970_0005011_1299_2075 258
146 3300048919 Ga0496116_0030023 Ga0496116_0030023_2744_3520 258
147 3300049569 Ga0501032_0175906 Ga0501032_0175906_102_878 258
148 3300049579 Ga0501043_0000112 Ga0501043_0000112_30486_31262 258
149 3300049580 Ga0501046_0000146 Ga0501046_0000146_30490_31266 258
150 3300049581 Ga0501047_0000192 Ga0501047_0000192_43039_43815 258
151 3300049582 Ga0501048_0010903 Ga0501048_0010903_3402_4178 258
152 3300049824 Ga0501045_0002598 Ga0501045_0002598_9720_10496 258
153 3300003316 rootH1_10069253 rootH1_100692531 259
154 3300005834 Ga0068851_10208999 Ga0068851_102089992 259
155 3300009011 Ga0105251_10006521 Ga0105251_100065214 259
156 3300009093 Ga0105240_10002809 Ga0105240_1000280917 259
157 3300009545 Ga0105237_10002917 Ga0105237_100029176 259
158 3300009551 Ga0105238_10081428 Ga0105238_100814284 259
159 3300010375 Ga0105239_10001353 Ga0105239_1000135315 259
160 3300025913 Ga0207695_10005251 Ga0207695_1000525111 259
161 3300025914 Ga0207671_10001552 Ga0207671_1000155214 259
162 3300025924 Ga0207694_10055362 Ga0207694_100553622 259
163 3300026121 Ga0207683_10096234 Ga0207683_100962342 259

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03883

H2O2_YaaD

Peroxide stress protein YaaA

24

281

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5caj-assembly2.cif.gz_B crystal structure of e. coli yaaa, a member of the duf328/upf0246 family 0.9908 1 255
5caj-assembly2.cif.gz_B crystal structure of e. coli yaaa, a member of the duf328/upf0246 family 0.9718 1 255
8ouz-assembly1.cif.gz_B human rad51b-rad51c-rad51d-xrcc2 (bcdx2) complex, 2.2 a resolution 0.7911 35 68
5y0n-assembly1.cif.gz_A crystal structure of bacillus subtilis tmcal bound with atp (semet derivative) 0.7297 28 68
8bsc-assembly1.cif.gz_D cryoem structure of the rad51 nucleoprotein filament in the presence of adp and ca2+ 0.6497 35 74
ID Description Score Start End Superfamily
6ib8C01 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.655 29 67 1.10.150.20
af_P0C0A2_317_386_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.6284 28 59 1.10.10.10
5tt5A05 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.6135 29 65 1.10.150.20
2bkeA01 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.602 28 74 1.10.150.20
5dcfA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.5943 28 74 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A5D0XQF4-F1-model_v4 Peroxide stress protein YaaA 1.001 21 148 GO:0005829
GO:0033194
AF-A0A836ZHI6-F1-model_v4 deleted 0.9997 1 126
AF-A0A7V7X912-F1-model_v4 deleted 0.9983 39 256
AF-N6YCL2-F1-model_v4 UPF0246 protein C664_00305 0.9979 1 255 GO:0005829
GO:0033194
AF-A0A844TU79-F1-model_v4 UPF0246 protein GOQ28_02325 0.9977 1 256 GO:0005829
GO:0033194

Feature Viewer

pLDDT pTM Quality
96.06 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map