F242484

General Info

Members Datasets Scaffolds Average Seq Length
163 109 326 138

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0000238|Ga0496121_0000238_114649_115116
Length 155
Sequence MLHFTGNHSPKDKFMTSTPSLLAGIGQSMRHLSERQRVIAQNIANGETPGFKAQTVEAPDFSSLVKIYDGGGGKPRVGRPQVHLSGGMAALGARAPLGGGGVIAESDISETKPDGNNVTLEDQLLKMGEVQSDFAAMTNLYRKQIGLLKTAIGRG

Samples

Sample ID Description Type Environment
1 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
19 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
20 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
21 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
22 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
23 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
24 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
25 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
26 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
27 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
28 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
29 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
34 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
35 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
36 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
37 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
38 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
39 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
40 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
41 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
42 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
43 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
44 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
45 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
46 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
47 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
48 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
49 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
50 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
51 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
52 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
53 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
54 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
55 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
56 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
57 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
58 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
59 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
60 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
61 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
62 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
63 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
64 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
65 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
66 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
67 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
68 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
69 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
70 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
71 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
72 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
73 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
74 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
75 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
76 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
77 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
78 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
79 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
80 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
81 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
82 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
83 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
84 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
85 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
86 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
90 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
91 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
92 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
93 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
94 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
95 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
96 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
97 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
98 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
99 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
100 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
101 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
102 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
103 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
104 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
105 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
106 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
107 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
108 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
109 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.87
Metatranscriptomes 0
Isolates 6.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.63
Nodule 0
Rhizoplane 1.23
Rhizosphere 51.53
Stem 0
Stem Tuber 0
Unclassified 1.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496121_0000238 3300048924 Bacteria 118593
2 JGI25152J39213_1019108 3300002773 Bacteria 1253
3 JGI25150J39212_1000116 3300002774 Bacteria 45393
4 JGI25151J46595_10013055 3300003187 Bacteria 3751
5 JGI25153J46596_10000342 3300003215 Bacteria 32966
6 rootH2_10062489 3300003320 Bacteria 4420
7 rootL2_10007744 3300003322 Bacteria 2292
8 rootL2_10019733 3300003322 Bacteria 2320
9 rootH1_10041343 3300003323 Bacteria 1597
10 rootH1_10052601 3300003323 Bacteria 3330
11 rootH1_10150082 3300003323 Bacteria 2086
12 Ga0055526_1010058 3300003771 Bacteria 4453
13 Ga0055536_1022560 3300003781 Bacteria 1875
14 Ga0055530_10024059 3300003791 Bacteria 1737
15 Ga0055540_1000629 3300003792 Bacteria 24978
16 Ga0065165_1004343 3300005262 Bacteria 8892
17 Ga0065165_1036628 3300005262 Bacteria 1495
18 Ga0065704_10000592 3300005289 Bacteria 16523
19 Ga0070668_100122310 3300005347 Bacteria 2082
20 Ga0070665_100056743 3300005548 Bacteria 3926
21 Ga0070665_100633620 3300005548 Bacteria 1082
22 Ga0068856_100028297 3300005614 Bacteria 5472
23 Ga0105243_10260502 3300009148 Bacteria 1552
24 Ga0105248_10005674 3300009177 Bacteria 13716
25 Ga0207425_1000088 3300025245 Bacteria 91367
26 Ga0209129_1000802 3300025258 Bacteria 19849
27 Ga0209675_1001244 3300025291 Bacteria 15316
28 Ga0209025_1001214 3300025294 Bacteria 36013
29 Ga0209564_1000769 3300025295 Bacteria 44684
30 Ga0209564_1015662 3300025295 Bacteria 3068
31 Ga0209758_1000009 3300025297 Bacteria 1123483
32 Ga0209050_1000005 3300025298 Bacteria 1557793
33 Ga0209050_1000277 3300025298 Bacteria 109132
34 Ga0209051_1000377 3300025303 Bacteria 63522
35 Ga0209257_1020402 3300025304 Bacteria 2451
36 Ga0209257_1020403 3300025304 Bacteria 2451
37 Ga0207709_10209342 3300025935 Bacteria 1398
38 Ga0207711_10514595 3300025941 Bacteria 1116
39 Ga0207668_10234434 3300025972 Bacteria 1481
40 Ga0268266_10026489 3300028379 Bacteria 4934
41 Ga0265325_10113704 3300031241 Bacteria 1313
42 Ga0265313_10080772 3300031595 Bacteria 1477
43 Ga0307412_10007530 3300031911 Bacteria 6182
44 Ga0307416_102775404 3300032002 Bacteria 586
45 Ga0307415_101520927 3300032126 Unclassified 641
46 Ga0395905_0052369 3300037471 Bacteria 3821
47 Ga0395905_0626213 3300037471 Bacteria 978
48 Ga0451577_0545655 3300042876 Bacteria 1053
49 Ga0466969_0003458 3300044656 Bacteria 8394
50 Ga0466966_0001423 3300044684 Bacteria 15420
51 Ga0466963_0133207 3300044694 Bacteria 1718
52 Ga0466971_0000881 3300044719 Bacteria 12254
53 Ga0466970_0011984 3300044765 Bacteria 4426
54 Ga0466957_0031788 3300044842 Bacteria 3156
55 Ga0466959_0022522 3300045049 Bacteria 4658
56 Ga0466958_0000425 3300045836 Bacteria 17411
57 Ga0495638_0000029 3300046460 Bacteria 330201
58 Ga0495638_0517815 3300046460 Bacteria 598
59 Ga0495650_0079169 3300046471 Bacteria 1271
60 Ga0495596_0001257 3300046500 Bacteria 14678
61 Ga0495596_0310754 3300046500 Bacteria 613
62 Ga0495607_0006371 3300046501 Bacteria 8311
63 Ga0495607_0232781 3300046501 Bacteria 895
64 Ga0495583_0000443 3300046506 Bacteria 62113
65 Ga0495606_0012131 3300046507 Bacteria 6947
66 Ga0495606_0076773 3300046507 Bacteria 2087
67 Ga0495610_0000015 3300046512 Bacteria 391489
68 Ga0495610_0004614 3300046512 Bacteria 10092
69 Ga0495616_0078386 3300046513 Bacteria 1585
70 Ga0495620_0055871 3300046515 Bacteria 1662
71 Ga0495631_0107559 3300046518 Bacteria 1199
72 Ga0495632_0000220 3300046519 Bacteria 58010
73 Ga0495632_0000689 3300046519 Bacteria 30742
74 Ga0495632_0032392 3300046519 Bacteria 2693
75 Ga0495632_0494595 3300046519 Bacteria 528
76 Ga0495643_0007676 3300046522 Bacteria 6919
77 Ga0495643_0033852 3300046522 Bacteria 2822
78 Ga0495648_0000020 3300046524 Bacteria 254330
79 Ga0495648_0016939 3300046524 Bacteria 5235
80 Ga0495663_0131566 3300046525 Bacteria 844
81 Ga0495654_0006399 3300046530 Bacteria 6695
82 Ga0495609_0005906 3300046538 Bacteria 6326
83 Ga0495609_0268667 3300046538 Bacteria 699
84 Ga0495633_0046563 3300046558 Bacteria 2051
85 Ga0495668_0357309 3300046616 Bacteria 802
86 Ga0495625_0003357 3300046660 Bacteria 16090
87 Ga0495625_0831537 3300046660 Bacteria 535
88 Ga0495670_0000003 3300046691 Bacteria 326779
89 Ga0495670_0337245 3300046691 Bacteria 810
90 Ga0495671_0000022 3300046692 Bacteria 255591
91 Ga0495671_0022116 3300046692 Bacteria 3334
92 Ga0495671_0419580 3300046692 Bacteria 640
93 Ga0495649_0208135 3300046694 Bacteria 1014
94 Ga0495683_0309852 3300047323 Bacteria 676
95 Ga0495673_0000051 3300047469 Bacteria 255511
96 Ga0495673_0132052 3300047469 Bacteria 980
97 Ga0495681_0013340 3300047470 Bacteria 4773
98 Ga0495686_0000245 3300047472 Bacteria 97784
99 Ga0495686_0001733 3300047472 Bacteria 22411
100 Ga0495686_0008313 3300047472 Bacteria 7631
101 Ga0495686_0216497 3300047472 Bacteria 1092
102 Ga0495615_0000016 3300048090 Bacteria 56891
103 Ga0495626_0000307 3300048091 Bacteria 51885
104 Ga0496108_0013127 3300048911 Bacteria 6751
105 Ga0496115_0000266 3300048918 Bacteria 46285
106 Ga0496116_0000017 3300048919 Bacteria 554463
107 Ga0496117_0012428 3300048920 Bacteria 7505
108 Ga0496117_0056688 3300048920 Bacteria 2727
109 Ga0496117_0553898 3300048920 Bacteria 547
110 Ga0496118_0018116 3300048921 Bacteria 6370
111 Ga0496118_0063644 3300048921 Bacteria 2712
112 Ga0496118_0362902 3300048921 Bacteria 767
113 Ga0496121_0008074 3300048924 Bacteria 12537
114 Ga0496121_0024728 3300048924 Bacteria 5732
115 Ga0496122_0000418 3300048925 Bacteria 90259
116 Ga0496122_0002375 3300048925 Bacteria 26961
117 Ga0496122_0002974 3300048925 Bacteria 23075
118 Ga0496122_0030536 3300048925 Bacteria 4512
119 Ga0496122_0034406 3300048925 Bacteria 4146
120 Ga0496123_0001477 3300048926 Bacteria 32622
121 Ga0496123_0006004 3300048926 Bacteria 11943
122 Ga0496123_0007921 3300048926 Bacteria 9867
123 Ga0496123_0009558 3300048926 Bacteria 8716
124 Ga0496124_0003358 3300048927 Bacteria 19672
125 Ga0496124_0007403 3300048927 Bacteria 11676
126 Ga0496124_0007988 3300048927 Bacteria 11132
127 Ga0496124_0504672 3300048927 Bacteria 810
128 Ga0496125_0009905 3300048928 Bacteria 9691
129 Ga0496125_0086873 3300048928 Bacteria 2363
130 Ga0496125_0189037 3300048928 Bacteria 1362
131 Ga0496125_0400242 3300048928 Bacteria 803
132 Ga0496126_0004275 3300048929 Bacteria 17181
133 Ga0496126_0026525 3300048929 Bacteria 5554
134 Ga0496126_0163374 3300048929 Bacteria 1902
135 Ga0496126_0526782 3300048929 Bacteria 941
136 Ga0496126_0984032 3300048929 Bacteria 634
137 Ga0501033_0852474 3300049570 Bacteria 614
138 Ga0501034_0698753 3300049571 Bacteria 913
139 Ga0501043_0067078 3300049579 Bacteria 2818
140 Ga0501043_0091922 3300049579 Bacteria 2386
141 Ga0501267_005489 3300049764 Bacteria 1201
142 Ga0501044_0018059 3300049823 Bacteria 7564
143 Ga0500643_000447 3300053087 Bacteria 30610
144 Ga0500643_000911 3300053087 Bacteria 18703
145 Ga0500566_0000177 3300053094 Bacteria 32478
146 Ga0500652_124538 3300053131 Bacteria 1077
147 Ga0500559_0011409 3300053136 Bacteria 3795
148 Ga0500559_0246874 3300053136 Bacteria 841
149 Ga0500622_0276202 3300053156 Unclassified 726
150 Ga0500624_000119 3300053157 Bacteria 35708
151 Ga0500636_0002009 3300053177 Bacteria 11199
152 Ga0500661_001517 3300055283 Bacteria 4366
153 Ga0466962_0000117 3300061719 Bacteria 32210
154 2511129247 2510917021 Bacteria 5705459
155 2512033335 2511231221 Bacteria 6846400
156 2523105774 2522572158 Bacteria 6514390
157 2599105672 2597490356 Bacteria 7030811
158 2819552987 2818991438 Bacteria 5793701
159 2846954642 2846952575 Bacteria 6587527
160 2848859093 2848858292 Bacteria 7391279
161 2897806969 2897803580 Bacteria 7000062
162 8054006411 8054002106 Bacteria 7987183
163 8054306644 8054302542 Bacteria 5698134
164 Ga0496121_0000238
165 JGI25152J39213_1019108
166 JGI25150J39212_1000116
167 JGI25151J46595_10013055
168 JGI25153J46596_10000342
169 rootH2_10062489
170 rootL2_10007744
171 rootL2_10019733
172 rootH1_10041343
173 rootH1_10052601
174 rootH1_10150082
175 Ga0055526_1010058
176 Ga0055536_1022560
177 Ga0055530_10024059
178 Ga0055540_1000629
179 Ga0065165_1004343
180 Ga0065165_1036628
181 Ga0065704_10000592
182 Ga0070668_100122310
183 Ga0070665_100056743
184 Ga0070665_100633620
185 Ga0068856_100028297
186 Ga0105243_10260502
187 Ga0105248_10005674
188 Ga0207425_1000088
189 Ga0209129_1000802
190 Ga0209675_1001244
191 Ga0209025_1001214
192 Ga0209564_1000769
193 Ga0209564_1015662
194 Ga0209758_1000009
195 Ga0209050_1000005
196 Ga0209050_1000277
197 Ga0209051_1000377
198 Ga0209257_1020402
199 Ga0209257_1020403
200 Ga0207709_10209342
201 Ga0207711_10514595
202 Ga0207668_10234434
203 Ga0268266_10026489
204 Ga0265325_10113704
205 Ga0265313_10080772
206 Ga0307412_10007530
207 Ga0307416_102775404
208 Ga0307415_101520927
209 Ga0395905_0052369
210 Ga0395905_0626213
211 Ga0451577_0545655
212 Ga0466969_0003458
213 Ga0466966_0001423
214 Ga0466963_0133207
215 Ga0466971_0000881
216 Ga0466970_0011984
217 Ga0466957_0031788
218 Ga0466959_0022522
219 Ga0466958_0000425
220 Ga0495638_0000029
221 Ga0495638_0517815
222 Ga0495650_0079169
223 Ga0495596_0001257
224 Ga0495596_0310754
225 Ga0495607_0006371
226 Ga0495607_0232781
227 Ga0495583_0000443
228 Ga0495606_0012131
229 Ga0495606_0076773
230 Ga0495610_0000015
231 Ga0495610_0004614
232 Ga0495616_0078386
233 Ga0495620_0055871
234 Ga0495631_0107559
235 Ga0495632_0000220
236 Ga0495632_0000689
237 Ga0495632_0032392
238 Ga0495632_0494595
239 Ga0495643_0007676
240 Ga0495643_0033852
241 Ga0495648_0000020
242 Ga0495648_0016939
243 Ga0495663_0131566
244 Ga0495654_0006399
245 Ga0495609_0005906
246 Ga0495609_0268667
247 Ga0495633_0046563
248 Ga0495668_0357309
249 Ga0495625_0003357
250 Ga0495625_0831537
251 Ga0495670_0000003
252 Ga0495670_0337245
253 Ga0495671_0000022
254 Ga0495671_0022116
255 Ga0495671_0419580
256 Ga0495649_0208135
257 Ga0495683_0309852
258 Ga0495673_0000051
259 Ga0495673_0132052
260 Ga0495681_0013340
261 Ga0495686_0000245
262 Ga0495686_0001733
263 Ga0495686_0008313
264 Ga0495686_0216497
265 Ga0495615_0000016
266 Ga0495626_0000307
267 Ga0496108_0013127
268 Ga0496115_0000266
269 Ga0496116_0000017
270 Ga0496117_0012428
271 Ga0496117_0056688
272 Ga0496117_0553898
273 Ga0496118_0018116
274 Ga0496118_0063644
275 Ga0496118_0362902
276 Ga0496121_0008074
277 Ga0496121_0024728
278 Ga0496122_0000418
279 Ga0496122_0002375
280 Ga0496122_0002974
281 Ga0496122_0030536
282 Ga0496122_0034406
283 Ga0496123_0001477
284 Ga0496123_0006004
285 Ga0496123_0007921
286 Ga0496123_0009558
287 Ga0496124_0003358
288 Ga0496124_0007403
289 Ga0496124_0007988
290 Ga0496124_0504672
291 Ga0496125_0009905
292 Ga0496125_0086873
293 Ga0496125_0189037
294 Ga0496125_0400242
295 Ga0496126_0004275
296 Ga0496126_0026525
297 Ga0496126_0163374
298 Ga0496126_0526782
299 Ga0496126_0984032
300 Ga0501033_0852474
301 Ga0501034_0698753
302 Ga0501043_0067078
303 Ga0501043_0091922
304 Ga0501267_005489
305 Ga0501044_0018059
306 Ga0500643_000447
307 Ga0500643_000911
308 Ga0500566_0000177
309 Ga0500652_124538
310 Ga0500559_0011409
311 Ga0500559_0246874
312 Ga0500622_0276202
313 Ga0500624_000119
314 Ga0500636_0002009
315 Ga0500661_001517
316 Ga0466962_0000117
317 2511129247
318 2512033335
319 2523105774
320 2599105672
321 2819552987
322 2846954642
323 2848859093
324 2897806969
325 8054006411
326 8054306644

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7nvg-assembly1.cif.gz_q2 salmonella flagellar basal body refined in c1 map 0.9023 10 40
7nvg-assembly1.cif.gz_l2 salmonella flagellar basal body refined in c1 map 0.8956 7 40
7cbm-assembly1.cif.gz_U cryo-em structure of the flagellar distal rod with partial hook from salmonella 0.8858 10 40
7cgo-assembly1.cif.gz_P cryo-em structure of the flagellar motor-hook complex from salmonella 0.8757 10 40
6jzr-assembly1.cif.gz_A structure of the bacterial flagellar polyrod 0.8323 7 45
ID Description Score Start End Superfamily
af_Q94K88_191_391_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.6322 7 131 1.25.40.10
af_G5EF80_191_470_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.6268 7 130 1.20.1270.60
af_G5EFD8_101_241_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5927 6 131 1.10.287.70
af_O94466_20_336_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.5897 6 123 1.20.1270.60
3tagD04 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;B family DNA polymerase, finger domain 0.5434 7 134 1.10.287.690
ID Description Score Start End GO Terms
AF-A0A3N5F692-F1-model_v4 Flagellar basal body rod protein FlgB 0.8537 7 133 GO:0030694
GO:0071973
AF-A0A388TEU7-F1-model_v4 Flagellar basal-body rod protein FlgB 0.7988 3 136
AF-A0A1Y0H8V7-F1-model_v4 Flagellar basal body rod protein FlgB 0.7805 5 136 GO:0030694
GO:0071978
AF-A0A142X3E7-F1-model_v4 Flagellar basal body rod protein FlgB 0.7663 1 132 GO:0030694
GO:0071973
AF-A0A2R8A9I0-F1-model_v4 Flagellar basal body rod protein FlgB 0.7629 5 136

Map