F242251

General Info

Members Datasets Scaffolds Average Seq Length
163 117 326 408

Family's Representative Sequence

Representative Sequence 3300045049|Ga0466959_0006466|Ga0466959_0006466_3057_4514
Length 467
Sequence LILIKLSESFYRPNTRYQRDERWSSLIMNKKWDLISLSSIPLIMTLGNSMLIPILPEIARKLHVSSFQVSLLITVYAIIAILLIPIAGYMSDLYGRKRIIVPSLIITGIGGAISAAAGWLLKDAAYWVILCGRLLQGVGAAGAAPIVMPLIGDIFYREKDVSKGLGIIETANTFGKVLSPVLGAFLGSLVWFFPFAAIPVFCAISIVMVTFGVDSPKKSRPTVSFAEFRSSVSSIFRQKGRWLYAIFLIGCICMFITFGVLFYLSSTLEEEFGIDGVMKGLVLAIPLAALCLASYTAGKTIGPDKIRMKWASFIGMALVTGSIFIIGWHENIYFVIGSLIVSGAGIGIVLPSLDAMITEGIDKEQRGTITSLYNSMRFIGVSLGPPLVSMLMRSSHRVLFFTLAFVCAMAGVLTLLSIRPRHAHGKPKAQESEPLDVIFQSSRRMEFGSPDKPKGFRFKIGSRLKRH

Samples

Sample ID Description Type Environment
1 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
5 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
6 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
7 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
8 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
9 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
10 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
11 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
12 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
13 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
14 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
15 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
16 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
17 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
18 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
19 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
20 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
21 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
22 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
23 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
24 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
25 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
26 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
27 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
28 2554235283 Bacillus safensis VK Isolate Rhizosphere
29 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
30 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
31 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
32 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
33 2643221729 Bacillus sp. Root11 Isolate Unclassified
34 2643221730 Bacillus sp. Root131 Isolate Unclassified
35 2643221735 Bacillus sp. Root920 Isolate Unclassified
36 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
37 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
38 2684622632 Bacillus cereus 905 Isolate Unclassified
39 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
40 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
41 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
42 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
43 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
44 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
45 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
46 2738541295 Bacillus sp. OK085 Isolate Unclassified
47 2738541358 Bacillus sp. OV752 Isolate Unclassified
48 2738543006 Bacillus sp. OK077 Isolate Unclassified
49 2738543010 Bacillus sp. YR335 Isolate Unclassified
50 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
51 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
52 2811994870 Bacillus sp. JB4 Isolate Unclassified
53 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
54 2818991441 Niallia circulans 3243 Isolate Rhizosphere
55 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
56 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
57 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
58 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
59 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
60 2860837431 Bacillus sp. WR11 Isolate Unclassified
61 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
62 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
63 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
64 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
65 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
66 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
67 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
68 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
69 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
70 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
71 2919726948 Bacillus pumilus 4489 Isolate Unclassified
72 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
73 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
74 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
75 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
76 2938917290 Bacillus sp. CR71 Isolate Unclassified
77 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
78 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
79 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
80 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
81 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
82 2965761152 Bacillus sp. COPE52 Isolate Unclassified
83 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
84 2969141011 Bacillus velezensis MH25 Isolate Unclassified
85 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
86 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
87 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
88 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
89 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
90 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
91 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
92 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
93 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
94 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
95 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
96 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
97 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
98 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
99 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
100 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
101 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
102 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
103 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
104 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
105 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
106 8022653035 Bacillus sp. Rc4 Isolate Unclassified
107 8022792930 Bacillus sp. Xin Isolate Rhizosphere
108 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
109 8023438354 Bacillus sp. BH2 Isolate Unclassified
110 8023444577 Bacillus sp. BH32 Isolate Unclassified
111 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
112 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
113 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
114 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
115 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
116 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
117 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 28.22
Metatranscriptomes 0
Isolates 71.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.56
Nodule 0
Rhizoplane 0.61
Rhizosphere 53.37
Stem 0
Stem Tuber 0
Unclassified 0.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466959_0006466 3300045049 Bacteria 8118
2 JGI25159J45721_1000936 3300002987 Bacteria 12733
3 JGI25159J45721_1011098 3300002987 Bacteria 2234
4 JGI25151J46595_10000012 3300003187 Bacteria 254028
5 JGI25151J46595_10000797 3300003187 Bacteria 25311
6 JGI25151J46595_10001238 3300003187 Bacteria 18180
7 JGI25151J46595_10002262 3300003187 Bacteria 11829
8 JGI25151J46595_10023256 3300003187 Bacteria 2557
9 Ga0055541_1002123 3300003841 Bacteria 4039
10 Ga0105244_10000483 3300009036 Bacteria 36008
11 Ga0105250_10004576 3300009092 Bacteria 6340
12 Ga0105250_10009375 3300009092 Bacteria 4125
13 Ga0157371_10128543 3300013102 Bacteria 1802
14 Ga0209566_100190 3300025225 Bacteria 64865
15 Ga0209147_101720 3300025229 Bacteria 7095
16 Ga0209130_1000539 3300025284 Bacteria 38091
17 Ga0209130_1001434 3300025284 Bacteria 15812
18 Ga0209130_1005635 3300025284 Bacteria 4288
19 Ga0209130_1005905 3300025284 Bacteria 4113
20 Ga0209676_1000988 3300025292 Bacteria 33733
21 Ga0209025_1000001 3300025294 Bacteria 1888151
22 Ga0209025_1001536 3300025294 Bacteria 29449
23 Ga0209025_1001661 3300025294 Bacteria 27369
24 Ga0209025_1001693 3300025294 Bacteria 26923
25 Ga0209025_1001896 3300025294 Bacteria 24396
26 Ga0209025_1002738 3300025294 Bacteria 17845
27 Ga0209025_1003566 3300025294 Bacteria 14568
28 Ga0209025_1003587 3300025294 Bacteria 14496
29 Ga0209025_1007094 3300025294 Bacteria 8475
30 Ga0209025_1008754 3300025294 Bacteria 7205
31 Ga0209025_1010736 3300025294 Bacteria 6160
32 Ga0209025_1010846 3300025294 Bacteria 6109
33 Ga0207696_1004044 3300025711 Bacteria 6430
34 Ga0207655_1002125 3300025728 Bacteria 16554
35 Ga0237817_10042 3300030083 Bacteria 44083
36 Ga0307408_100016835 3300031548 Bacteria 4886
37 Ga0307408_100179507 3300031548 Bacteria 1697
38 Ga0307409_100032911 3300031995 Bacteria 3766
39 Ga0237819_00015 3300038705 Bacteria 58052
40 Ga0237819_00190 3300038705 Bacteria 22632
41 Ga0466961_0163236 3300044693 Bacteria 1388
42 Ga0466967_0000610 3300045976 Bacteria 17839
43 Ga0466967_0330049 3300045976 Bacteria 1473
44 Ga0495622_0025450 3300046557 Unclassified 2764
45 Ga0495660_0050915 3300046810 Bacteria 2255
46 Ga0496110_0443672 3300048913 Bacteria 1183
47 2511699584 2511231119 Bacteria 4019861
48 2540606232 2540341094 Bacteria 4061186
49 2540606810 2540341094 Bacteria 4061186
50 2545556204 2545555800 Bacteria 4222588
51 2553392372 2551306519 Bacteria 5465154
52 2555469043 2554235283 Bacteria 3683090
53 2578929635 2576861599 Bacteria 4217202
54 2587745249 2585428059 Bacteria 8696589
55 2631982837 2630968484 Bacteria 3876276
56 2644424153 2643221676 Bacteria 8119172
57 2644704421 2643221729 Bacteria 6621700
58 2644709115 2643221730 Bacteria 6523787
59 2644739983 2643221735 Bacteria 3676263
60 2651532994 2648501850 Bacteria 3975476
61 2674419886 2671180844 Bacteria 4164150
62 2685149865 2684622632 Bacteria 5380049
63 2686996865 2684623153 Bacteria 3878815
64 2687498168 2687453109 Bacteria 3860091
65 2695627535 2695420354 Bacteria 3922431
66 2698323334 2695420987 Bacteria 6152737
67 2705993837 2703719227 Bacteria 5631989
68 2717916671 2716884898 Bacteria 3928789
69 2721505216 2718218445 Bacteria 5113413
70 2738813444 2738541295 Bacteria 5730091
71 2738816022 2738541295 Bacteria 5730091
72 2739159169 2738541358 Bacteria 5932299
73 2739211829 2738543006 Bacteria 5904091
74 2739231192 2738543010 Bacteria 5583595
75 2791213912 2788500588 Bacteria 4584915
76 2809054438 2808606399 Bacteria 4021018
77 2809055062 2808606399 Bacteria 4021018
78 2812316035 2811994870 Bacteria 3776934
79 2817479948 2816332295 Bacteria 4352468
80 2817480242 2816332295 Bacteria 4352468
81 2819567941 2818991441 Bacteria 5062707
82 2819570169 2818991441 Bacteria 5062707
83 2819579005 2818991443 Bacteria 6598732
84 2819724796 2818991468 Bacteria 3723169
85 2823528008 2823526263 Bacteria 3765752
86 2852675192 2852673933 Bacteria 3347676
87 2857454498 2857453340 Bacteria 8090534
88 2857460269 2857453340 Bacteria 8090534
89 2860838611 2860837431 Bacteria 4202080
90 2860839257 2860837431 Bacteria 4202080
91 2877770362 2877768649 Bacteria 3957164
92 2880171365 2880169592 Bacteria 3900066
93 2881647117 2881644220 Bacteria 5302661
94 2881648733 2881644220 Bacteria 5302661
95 2897111384 2897109615 Bacteria 4009619
96 2904560904 2904560550 Bacteria 4029838
97 2908665707 2908665501 Bacteria 3678115
98 2916975136 2916971899 Bacteria 4250608
99 2919094120 2919093281 Bacteria 3660974
100 2919414285 2919414237 Bacteria 5429133
101 2919414924 2919414237 Bacteria 5429133
102 2919431191 2919425241 Bacteria 8055701
103 2919729010 2919726948 Bacteria 3696050
104 2928513682 2928510474 Bacteria 4815308
105 2929209093 2929206907 Bacteria 5918291
106 2929235130 2929233124 Bacteria 5948380
107 2936365659 2936361878 Bacteria 5632809
108 2938919306 2938917290 Bacteria 5914775
109 2947428679 2947426588 Bacteria 5357194
110 2954774483 2954773129 Bacteria 3741715
111 2956898388 2956897341 Bacteria 5447711
112 2962291996 2962290636 Bacteria 4072939
113 2962292701 2962290636 Bacteria 4072939
114 2964379500 2964375228 Bacteria 4909004
115 2965763174 2965761152 Bacteria 5806513
116 2969138016 2969136845 Bacteria 3923176
117 2969138646 2969136845 Bacteria 3923176
118 2969142814 2969141011 Bacteria 4118468
119 2969766649 2969765954 Bacteria 4216713
120 2969768196 2969765954 Bacteria 4216713
121 2969771800 2969770375 Bacteria 4271280
122 2969772442 2969770375 Bacteria 4271280
123 2971416302 2971410472 Bacteria 8311090
124 2971895130 2971893375 Bacteria 3929648
125 2977257008 2977254563 Bacteria 4828420
126 2979085612 2979083700 Bacteria 5894929
127 2980493793 2980492589 Bacteria 4072961
128 2980494441 2980492589 Bacteria 4072961
129 2990277888 2990275345 Bacteria 4887158
130 3001268070 3001267043 Bacteria 4823521
131 3001271773 3001267043 Bacteria 4823521
132 3001273575 3001272096 Bacteria 4729684
133 3001276912 3001272096 Bacteria 4729684
134 3001893204 3001892409 Bacteria 6328293
135 3001898181 3001892409 Bacteria 6328293
136 3006860288 3006858327 Bacteria 4317835
137 3006860580 3006858327 Bacteria 4317835
138 3006880255 3006879489 Bacteria 4064221
139 3006880889 3006879489 Bacteria 4064221
140 3006973078 3006969106 Bacteria 4739423
141 3006975507 3006973921 Bacteria 4423788
142 3006983810 3006978542 Bacteria 5328100
143 3006984964 3006984091 Bacteria 4207523
144 3006985040 3006984091 Bacteria 4207523
145 3006989249 3006988479 Bacteria 4767936
146 3006992818 3006988479 Bacteria 4767936
147 8002322503 8002317523 Bacteria 8051857
148 8022625869 8022621104 Bacteria 5241040
149 8022630986 8022630665 Bacteria 3886130
150 8022653581 8022653035 Bacteria 4035078
151 8022655183 8022653035 Bacteria 4035078
152 8022794350 8022792930 Bacteria 5693794
153 8022949195 8022948649 Bacteria 5366783
154 8023444559 8023438354 Bacteria 5779374
155 8023448397 8023444577 Bacteria 5661597
156 8046998145 8046991243 Bacteria 8497463
157 8051952740 8051952484 Bacteria 3926774
158 8052174762 8052174270 Bacteria 3881265
159 8054281834 8054280661 Bacteria 4232245
160 8056534617 8056533031 Bacteria 8964429
161 8056540458 8056533031 Bacteria 8964429
162 8057584657 8057582654 Bacteria 5218944
163 8057634919 8057632132 Bacteria 4726859
164 Ga0466959_0006466
165 JGI25159J45721_1000936
166 JGI25159J45721_1011098
167 JGI25151J46595_10000012
168 JGI25151J46595_10000797
169 JGI25151J46595_10001238
170 JGI25151J46595_10002262
171 JGI25151J46595_10023256
172 Ga0055541_1002123
173 Ga0105244_10000483
174 Ga0105250_10004576
175 Ga0105250_10009375
176 Ga0157371_10128543
177 Ga0209566_100190
178 Ga0209147_101720
179 Ga0209130_1000539
180 Ga0209130_1001434
181 Ga0209130_1005635
182 Ga0209130_1005905
183 Ga0209676_1000988
184 Ga0209025_1000001
185 Ga0209025_1001536
186 Ga0209025_1001661
187 Ga0209025_1001693
188 Ga0209025_1001896
189 Ga0209025_1002738
190 Ga0209025_1003566
191 Ga0209025_1003587
192 Ga0209025_1007094
193 Ga0209025_1008754
194 Ga0209025_1010736
195 Ga0209025_1010846
196 Ga0207696_1004044
197 Ga0207655_1002125
198 Ga0237817_10042
199 Ga0307408_100016835
200 Ga0307408_100179507
201 Ga0307409_100032911
202 Ga0237819_00015
203 Ga0237819_00190
204 Ga0466961_0163236
205 Ga0466967_0000610
206 Ga0466967_0330049
207 Ga0495622_0025450
208 Ga0495660_0050915
209 Ga0496110_0443672
210 2511699584
211 2540606232
212 2540606810
213 2545556204
214 2553392372
215 2555469043
216 2578929635
217 2587745249
218 2631982837
219 2644424153
220 2644704421
221 2644709115
222 2644739983
223 2651532994
224 2674419886
225 2685149865
226 2686996865
227 2687498168
228 2695627535
229 2698323334
230 2705993837
231 2717916671
232 2721505216
233 2738813444
234 2738816022
235 2739159169
236 2739211829
237 2739231192
238 2791213912
239 2809054438
240 2809055062
241 2812316035
242 2817479948
243 2817480242
244 2819567941
245 2819570169
246 2819579005
247 2819724796
248 2823528008
249 2852675192
250 2857454498
251 2857460269
252 2860838611
253 2860839257
254 2877770362
255 2880171365
256 2881647117
257 2881648733
258 2897111384
259 2904560904
260 2908665707
261 2916975136
262 2919094120
263 2919414285
264 2919414924
265 2919431191
266 2919729010
267 2928513682
268 2929209093
269 2929235130
270 2936365659
271 2938919306
272 2947428679
273 2954774483
274 2956898388
275 2962291996
276 2962292701
277 2964379500
278 2965763174
279 2969138016
280 2969138646
281 2969142814
282 2969766649
283 2969768196
284 2969771800
285 2969772442
286 2971416302
287 2971895130
288 2977257008
289 2979085612
290 2980493793
291 2980494441
292 2990277888
293 3001268070
294 3001271773
295 3001273575
296 3001276912
297 3001893204
298 3001898181
299 3006860288
300 3006860580
301 3006880255
302 3006880889
303 3006973078
304 3006975507
305 3006983810
306 3006984964
307 3006985040
308 3006989249
309 3006992818
310 8002322503
311 8022625869
312 8022630986
313 8022653581
314 8022655183
315 8022794350
316 8022949195
317 8023444559
318 8023448397
319 8046998145
320 8051952740
321 8052174762
322 8054281834
323 8056534617
324 8056540458
325 8057584657
326 8057634919

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

37

385

0.89

PF07690

MFS_1

Major Facilitator Superfamily

264

460

0.84

PF13347

MFS_2

MFS/sugar transport protein

172

418

0.79

PF00083

Sugar_tr

Sugar (and other) transporter

10

217

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
7sp5-assembly2.cif.gz_B crystal structure of a eukaryotic phosphate transporter 0.7642 13 367
8t6b-assembly1.cif.gz_A human vmat2 in complex with serotonin 0.7635 14 367
6e9o-assembly2.cif.gz_A e. coli d-galactonate:proton symporter mutant e133q in the outward substrate-bound form 0.7635 12 371
8g92-assembly1.cif.gz_A structure of inhibitor 16d-bound spns2 0.7571 12 367
8hnc-assembly1.cif.gz_A cryo-em structure of human oatp1b1 in complex with bilirubin 0.7516 17 370
ID Description Score Start End Superfamily
af_Q59WF2_48_242_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9196 17 182 1.20.1250.20
af_O69695_42_237_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.913 17 181 1.20.1250.20
af_P39398_32_230_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9106 8 183 1.20.1250.20
af_P9WG91_8_214_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9045 17 181 1.20.1250.20
af_Q2G226_6_195_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8995 12 182 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2V9RJV5-F1-model_v4 MFS transporter 0.8832 23 182 GO:0016020
GO:0022857
AF-A0A842YDF2-F1-model_v4 MFS transporter 0.8747 3 182 GO:0005886
GO:0022857
AF-A0A7X7SSR9-F1-model_v4 MFS transporter 0.873 13 182 GO:0016020
GO:0022857
AF-A0A059WQ33-F1-model_v4 Drug resistance transporter, Bcr/CflA subfamily 0.8656 17 182 GO:0005886
GO:0015385
GO:0042910
GO:1990961
AF-A0A2R7QXH1-F1-model_v4 MFS transporter 0.8598 14 177 GO:0016020
GO:0022857

Map