F240848

General Info

Members Datasets Scaffolds Average Seq Length
163 121 326 126

Family's Representative Sequence

Representative Sequence 3300005333|Ga0070677_10317040|Ga0070677_103170402
Length 139
Sequence VRILIDTHCLLWALARPEALNVDAVALLSSDETEVVVSAVSIWEIAIKSGLGKLRVSLTDGDSLFDIIDRQPLTPLPILHSHARQVASLPLHHADPFDRLLIAQGQIEGLPIMTADDQFLRYEIEVIWATRQKPRRRRR

Samples

Sample ID Description Type Environment
1 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
35 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
59 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
60 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
61 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
89 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
90 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
91 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
92 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
93 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
94 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
98 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
99 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
100 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
101 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
102 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
104 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
105 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
106 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
107 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
108 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
109 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
110 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
111 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
112 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
113 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
118 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
119 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
120 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
121 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.77
Metatranscriptomes 1.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.61
Rhizosphere 98.77
Stem 0
Stem Tuber 0
Unclassified 18.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070677_10317040 3300005333 Bacteria 797
2 Ga0070683_101100115 3300005329 Bacteria 763
3 Ga0068868_100001744 3300005338 Bacteria 14909
4 Ga0070661_100900308 3300005344 Bacteria 730
5 Ga0070675_100000003 3300005354 Bacteria 422595
6 Ga0070671_100053945 3300005355 Bacteria 3341
7 Ga0070667_100124865 3300005367 Bacteria 2242
8 Ga0070714_100106616 3300005435 Bacteria 2476
9 Ga0070713_100220643 3300005436 Bacteria 1720
10 Ga0070708_100302864 3300005445 Unclassified 1505
11 Ga0068867_100115499 3300005459 Bacteria 2067
12 Ga0070707_100180364 3300005468 Bacteria 2058
13 Ga0070707_100418902 3300005468 Unclassified 1300
14 Ga0070684_100485136 3300005535 Bacteria 1144
15 Ga0068853_100155840 3300005539 Bacteria 2058
16 Ga0070695_100450669 3300005545 Unclassified 986
17 Ga0070665_100008566 3300005548 Bacteria 10349
18 Ga0068857_101056491 3300005577 Bacteria 783
19 Ga0068856_100017471 3300005614 Bacteria 6950
20 Ga0068856_101362056 3300005614 Unclassified 724
21 Ga0068852_100359873 3300005616 Bacteria 1423
22 Ga0068859_100020418 3300005617 Bacteria 6649
23 Ga0068859_102400016 3300005617 Bacteria 581
24 Ga0068864_100468025 3300005618 Bacteria 1208
25 Ga0068864_100865262 3300005618 Bacteria 891
26 Ga0068863_100935629 3300005841 Bacteria 868
27 Ga0068858_100189935 3300005842 Bacteria 1941
28 Ga0068858_100412132 3300005842 Bacteria 1299
29 Ga0068860_100127626 3300005843 Bacteria 2438
30 Ga0081538_10017471 3300005981 Bacteria 5443
31 Ga0081539_10255977 3300005985 Bacteria 775
32 Ga0070717_10013650 3300006028 Bacteria 6231
33 Ga0070717_10013699 3300006028 Bacteria 6221
34 Ga0070717_10051373 3300006028 Bacteria 3392
35 Ga0070717_11130234 3300006028 Bacteria 713
36 Ga0070712_101986152 3300006175 Bacteria 509
37 Ga0097621_100007230 3300006237 Bacteria 7925
38 Ga0097621_100047885 3300006237 Bacteria 3465
39 Ga0097621_101688606 3300006237 Unclassified 603
40 Ga0068871_100062797 3300006358 Bacteria 3037
41 Ga0068871_100474005 3300006358 Bacteria 1125
42 Ga0068871_100966221 3300006358 Bacteria 792
43 Ga0075434_101358259 3300006871 Unclassified 721
44 Ga0075429_101496905 3300006880 Unclassified 587
45 Ga0097620_100020418 3300006931 Bacteria 6649
46 Ga0097620_102399870 3300006931 Bacteria 581
47 Ga0099795_10071375 3300007788 Bacteria 1311
48 Ga0099795_10147103 3300007788 Unclassified 962
49 Ga0099795_10215121 3300007788 Bacteria 816
50 Ga0105244_10028602 3300009036 Bacteria 2987
51 Ga0105240_10018720 3300009093 Bacteria 9278
52 Ga0105240_11210240 3300009093 Unclassified 800
53 Ga0105245_10051099 3300009098 Bacteria 3706
54 Ga0105245_10563767 3300009098 Bacteria 1162
55 Ga0105245_10676090 3300009098 Bacteria 1064
56 Ga0105247_10226212 3300009101 Bacteria 1268
57 Ga0114129_10001460 3300009147 Bacteria 31941
58 Ga0105243_11667576 3300009148 Bacteria 666
59 Ga0105241_10002797 3300009174 Bacteria 13060
60 Ga0105241_10032288 3300009174 Bacteria 3924
61 Ga0105241_10719449 3300009174 Unclassified 913
62 Ga0105242_10113695 3300009176 Bacteria 2312
63 Ga0105242_11608305 3300009176 Unclassified 684
64 Ga0105248_10310231 3300009177 Bacteria 1777
65 Ga0105248_10660798 3300009177 Bacteria 1179
66 Ga0105237_10243019 3300009545 Bacteria 1801
67 Ga0105237_11658220 3300009545 Bacteria 646
68 Ga0105238_10004582 3300009551 Bacteria 13667
69 Ga0105238_10010862 3300009551 Bacteria 9152
70 Ga0105238_10272663 3300009551 Bacteria 1672
71 Ga0105238_10563133 3300009551 Bacteria 1145
72 Ga0099796_10033190 3300010159 Bacteria 1697
73 Ga0105239_10798568 3300010375 Bacteria 1081
74 Ga0105246_10183955 3300011119 Bacteria 1611
75 Ga0157373_11413179 3300013100 Bacteria 529
76 Ga0157374_10220825 3300013296 Bacteria 1859
77 Ga0157374_10848899 3300013296 Bacteria 930
78 Ga0157374_11392875 3300013296 Unclassified 724
79 Ga0157378_10026539 3300013297 Bacteria 5106
80 Ga0157378_10080571 3300013297 Bacteria 2941
81 Ga0163162_10003010 3300013306 Bacteria 16108
82 Ga0157372_10008009 3300013307 Bacteria 11240
83 Ga0157375_10002947 3300013308 Bacteria 14769
84 Ga0163163_10054171 3300014325 Bacteria 3962
85 Ga0163163_10105828 3300014325 Bacteria 2839
86 Ga0157377_10473301 3300014745 Bacteria 870
87 Ga0157376_10941886 3300014969 Bacteria 884
88 Ga0224570_102642 3300022730 Unclassified 1182
89 Ga0224569_110817 3300022732 Unclassified 643
90 Ga0228598_1053591 3300024227 Unclassified 800
91 Ga0207655_1056246 3300025728 Bacteria 1552
92 Ga0207710_10142329 3300025900 Bacteria 1158
93 Ga0207684_10266187 3300025910 Unclassified 1479
94 Ga0207654_10008097 3300025911 Bacteria 5300
95 Ga0207654_10192319 3300025911 Bacteria 1338
96 Ga0207695_10033456 3300025913 Bacteria 5605
97 Ga0207671_11007150 3300025914 Bacteria 656
98 Ga0207693_10852102 3300025915 Bacteria 701
99 Ga0207646_10372320 3300025922 Unclassified 1290
100 Ga0207694_10003244 3300025924 Bacteria 12965
101 Ga0207694_10012912 3300025924 Bacteria 6290
102 Ga0207694_10031802 3300025924 Bacteria 4034
103 Ga0207650_11009349 3300025925 Bacteria 708
104 Ga0207687_10157423 3300025927 Bacteria 1740
105 Ga0207687_10794549 3300025927 Bacteria 807
106 Ga0207700_10364035 3300025928 Bacteria 1261
107 Ga0207664_10084303 3300025929 Bacteria 2592
108 Ga0207644_10907535 3300025931 Bacteria 738
109 Ga0207686_10067252 3300025934 Bacteria 2292
110 Ga0207670_11642799 3300025936 Bacteria 546
111 Ga0207658_10130208 3300025986 Bacteria 2020
112 Ga0207677_10002199 3300026023 Bacteria 10246
113 Ga0207703_10446267 3300026035 Bacteria 1208
114 Ga0207702_10012004 3300026078 Bacteria 7202
115 Ga0207641_10400735 3300026088 Bacteria 1317
116 Ga0207676_10545724 3300026095 Bacteria 1107
117 Ga0207676_11375968 3300026095 Bacteria 701
118 Ga0207674_11027108 3300026116 Bacteria 794
119 Ga0207675_102149863 3300026118 Unclassified 574
120 Ga0268266_10003108 3300028379 Bacteria 16915
121 Ga0268264_10211710 3300028381 Bacteria 1780
122 Ga0265760_10069013 3300031090 Unclassified 1082
123 Ga0265330_10122474 3300031235 Bacteria 1108
124 Ga0265325_10247249 3300031241 Unclassified 809
125 Ga0265340_10074833 3300031247 Unclassified 1601
126 Ga0265340_10083117 3300031247 Bacteria 1505
127 Ga0265339_10060923 3300031249 Bacteria 2032
128 Ga0265316_10007966 3300031344 Bacteria 9904
129 Ga0265316_10042440 3300031344 Bacteria 3635
130 Ga0265316_10601318 3300031344 Bacteria 780
131 Ga0265314_10006097 3300031711 Bacteria 10713
132 Ga0265342_10442464 3300031712 Bacteria 668
133 Ga0307416_101787927 3300032002 Bacteria 719
134 Ga0316053_104053 3300032120 Bacteria 890
135 Ga0373936_0006094 3300035113 Bacteria 4543
136 Ga0373943_0080631 3300035170 Unclassified 1668
137 Ga0373935_0786650 3300035692 Unclassified 702
138 Ga0373935_1021402 3300035692 Unclassified 614
139 Ga0373927_0304530 3300035695 Bacteria 1049
140 Ga0373947_0070238 3300035725 Bacteria 2145
141 Ga0373947_0503137 3300035725 Bacteria 823
142 Ga0373937_0382555 3300036401 Bacteria 1335
143 Ga0373937_1332753 3300036401 Unclassified 666
144 Ga0373925_0084336 3300037068 Bacteria 2421
145 Ga0436360_1129426 3300039438 Unclassified 823
146 Ga0436363_0662641 3300039450 Unclassified 534
147 Ga0495590_0021008 3300046457 Bacteria 2317
148 Ga0495651_0458120 3300046462 Unclassified 823
149 Ga0495580_0535893 3300046472 Bacteria 779
150 Ga0495645_0059846 3300046543 Bacteria 2761
151 Ga0495658_0410632 3300046683 Bacteria 863
152 Ga0495674_1355377 3300047319 Unclassified 532
153 Ga0496106_0540598 3300048909 Bacteria 935
154 Ga0501033_0069346 3300049570 Unclassified 2592
155 Ga0501034_0033222 3300049571 Bacteria 5236
156 Ga0501034_1035452 3300049571 Bacteria 704
157 Ga0501043_0160430 3300049579 Bacteria 1757
158 Ga0501047_0028988 3300049581 Bacteria 5339
159 Ga0501068_0009001 3300049584 Bacteria 5571
160 Ga0501070_0015356 3300049586 Bacteria 6444
161 Ga0501080_0513431 3300049742 Bacteria 1070
162 Ga0501044_0103274 3300049823 Bacteria 2865
163 nmdc:mga05p37_4189_c1 3300050507 Bacteria 16859
164 Ga0070677_10317040
165 Ga0070683_101100115
166 Ga0068868_100001744
167 Ga0070661_100900308
168 Ga0070675_100000003
169 Ga0070671_100053945
170 Ga0070667_100124865
171 Ga0070714_100106616
172 Ga0070713_100220643
173 Ga0070708_100302864
174 Ga0068867_100115499
175 Ga0070707_100180364
176 Ga0070707_100418902
177 Ga0070684_100485136
178 Ga0068853_100155840
179 Ga0070695_100450669
180 Ga0070665_100008566
181 Ga0068857_101056491
182 Ga0068856_100017471
183 Ga0068856_101362056
184 Ga0068852_100359873
185 Ga0068859_100020418
186 Ga0068859_102400016
187 Ga0068864_100468025
188 Ga0068864_100865262
189 Ga0068863_100935629
190 Ga0068858_100189935
191 Ga0068858_100412132
192 Ga0068860_100127626
193 Ga0081538_10017471
194 Ga0081539_10255977
195 Ga0070717_10013650
196 Ga0070717_10013699
197 Ga0070717_10051373
198 Ga0070717_11130234
199 Ga0070712_101986152
200 Ga0097621_100007230
201 Ga0097621_100047885
202 Ga0097621_101688606
203 Ga0068871_100062797
204 Ga0068871_100474005
205 Ga0068871_100966221
206 Ga0075434_101358259
207 Ga0075429_101496905
208 Ga0097620_100020418
209 Ga0097620_102399870
210 Ga0099795_10071375
211 Ga0099795_10147103
212 Ga0099795_10215121
213 Ga0105244_10028602
214 Ga0105240_10018720
215 Ga0105240_11210240
216 Ga0105245_10051099
217 Ga0105245_10563767
218 Ga0105245_10676090
219 Ga0105247_10226212
220 Ga0114129_10001460
221 Ga0105243_11667576
222 Ga0105241_10002797
223 Ga0105241_10032288
224 Ga0105241_10719449
225 Ga0105242_10113695
226 Ga0105242_11608305
227 Ga0105248_10310231
228 Ga0105248_10660798
229 Ga0105237_10243019
230 Ga0105237_11658220
231 Ga0105238_10004582
232 Ga0105238_10010862
233 Ga0105238_10272663
234 Ga0105238_10563133
235 Ga0099796_10033190
236 Ga0105239_10798568
237 Ga0105246_10183955
238 Ga0157373_11413179
239 Ga0157374_10220825
240 Ga0157374_10848899
241 Ga0157374_11392875
242 Ga0157378_10026539
243 Ga0157378_10080571
244 Ga0163162_10003010
245 Ga0157372_10008009
246 Ga0157375_10002947
247 Ga0163163_10054171
248 Ga0163163_10105828
249 Ga0157377_10473301
250 Ga0157376_10941886
251 Ga0224570_102642
252 Ga0224569_110817
253 Ga0228598_1053591
254 Ga0207655_1056246
255 Ga0207710_10142329
256 Ga0207684_10266187
257 Ga0207654_10008097
258 Ga0207654_10192319
259 Ga0207695_10033456
260 Ga0207671_11007150
261 Ga0207693_10852102
262 Ga0207646_10372320
263 Ga0207694_10003244
264 Ga0207694_10012912
265 Ga0207694_10031802
266 Ga0207650_11009349
267 Ga0207687_10157423
268 Ga0207687_10794549
269 Ga0207700_10364035
270 Ga0207664_10084303
271 Ga0207644_10907535
272 Ga0207686_10067252
273 Ga0207670_11642799
274 Ga0207658_10130208
275 Ga0207677_10002199
276 Ga0207703_10446267
277 Ga0207702_10012004
278 Ga0207641_10400735
279 Ga0207676_10545724
280 Ga0207676_11375968
281 Ga0207674_11027108
282 Ga0207675_102149863
283 Ga0268266_10003108
284 Ga0268264_10211710
285 Ga0265760_10069013
286 Ga0265330_10122474
287 Ga0265325_10247249
288 Ga0265340_10074833
289 Ga0265340_10083117
290 Ga0265339_10060923
291 Ga0265316_10007966
292 Ga0265316_10042440
293 Ga0265316_10601318
294 Ga0265314_10006097
295 Ga0265342_10442464
296 Ga0307416_101787927
297 Ga0316053_104053
298 Ga0373936_0006094
299 Ga0373943_0080631
300 Ga0373935_0786650
301 Ga0373935_1021402
302 Ga0373927_0304530
303 Ga0373947_0070238
304 Ga0373947_0503137
305 Ga0373937_0382555
306 Ga0373937_1332753
307 Ga0373925_0084336
308 Ga0436360_1129426
309 Ga0436363_0662641
310 Ga0495590_0021008
311 Ga0495651_0458120
312 Ga0495580_0535893
313 Ga0495645_0059846
314 Ga0495658_0410632
315 Ga0495674_1355377
316 Ga0496106_0540598
317 Ga0501033_0069346
318 Ga0501034_0033222
319 Ga0501034_1035452
320 Ga0501043_0160430
321 Ga0501047_0028988
322 Ga0501068_0009001
323 Ga0501070_0015356
324 Ga0501080_0513431
325 Ga0501044_0103274
326 nmdc:mga05p37_4189_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

3

125

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xgr-assembly1.cif.gz_A crystal structure of addiction module from mycobacterial species 0.7609 3 123
7by2-assembly1.cif.gz_B-2 toxin-antitoxin complex from klebsiella pneumoniae 0.751 4 123
5x3t-assembly1.cif.gz_H vapbc from mycobacterium tuberculosis 0.7439 1 113
4xgq-assembly2.cif.gz_G crystal structure of addiction module from mycobacterial species 0.7418 3 123
4xgr-assembly1.cif.gz_A crystal structure of addiction module from mycobacterial species 0.7393 3 123
ID Description Score Start End Superfamily
af_P71623_4_126_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8348 4 120 3.40.50.1010
af_P71623_4_126_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7925 4 120 3.40.50.1010
af_O53779_1_126_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7914 4 116 3.40.50.1010
af_P9WF65_1_129_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7886 4 119 3.40.50.1010
af_P9WF57_1_130_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7828 4 121 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A535YR32-F1-model_v4 Type II toxin-antitoxin system VapC family toxin 0.9877 1 123
AF-A0A1L7F4Q8-F1-model_v4 deleted 0.9825 1 124
AF-A0A1H3HK24-F1-model_v4 PIN domain nuclease, a component of toxin-antitoxin system (PIN domain) 0.9823 1 124 GO:0004518
AF-A0A1Z4KU48-F1-model_v4 PilT domain-containing protein 0.9792 59 122
AF-A0A7V1EC57-F1-model_v4 PIN domain-containing protein 0.9777 1 123

Map