F239859

General Info

Members Datasets Scaffolds Average Seq Length
162 128 324 161

Family's Representative Sequence

Representative Sequence 3300041456|Ga0451795_0373639|Ga0451795_0373639_49_540
Length 163
Sequence MNNDPVISDPTTWALDREIVLVRVLDAPRHAVFEAWTDAAAFCQWFGPHGFTCTVREMDVRPGGRARFDMVSTDGTVVYTNRFDYLQVVPAERLVMDHGSDIDDDPARFRVTITLDEQGDGKTVLTLRQLHPTAAQRKAKLGFGAVELGLQTLDKLARHLEVA

Samples

Sample ID Description Type Environment
1 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
2 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
3 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
6 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
7 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
8 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
9 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
10 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
11 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
12 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
13 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
14 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
15 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
16 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
17 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
18 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
19 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
20 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
21 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
22 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
25 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
26 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
27 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
28 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
29 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
32 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
35 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
36 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
37 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
38 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
39 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
40 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
41 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
59 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
62 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
63 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
64 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
65 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
66 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
67 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
68 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
69 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
70 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
71 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
72 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
73 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
74 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
75 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
76 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
77 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
78 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
79 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
80 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
81 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
82 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
83 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
84 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
85 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
86 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
87 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
88 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
89 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
90 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
91 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
92 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
93 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
94 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
95 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
96 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
97 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
98 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
99 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
100 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
101 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
102 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
103 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
112 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
113 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
114 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
115 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
116 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
117 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
119 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
120 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
121 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
122 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
123 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
124 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
125 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
126 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
127 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
128 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.38
Metatranscriptomes 0.62
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.35
Nodule 0
Rhizoplane 9.88
Rhizosphere 70.37
Stem 0
Stem Tuber 0
Unclassified 11.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451795_0373639 3300041456 Unclassified 560
2 Ga0070666_11183175 3300005335 Bacteria 569
3 Ga0070661_100445819 3300005344 Bacteria 1029
4 Ga0070671_100738962 3300005355 Bacteria 855
5 Ga0070685_10377379 3300005466 Bacteria 976
6 Ga0070685_10745260 3300005466 Bacteria 718
7 Ga0070706_100097385 3300005467 Bacteria 2732
8 Ga0070679_100718269 3300005530 Bacteria 942
9 Ga0070672_101024846 3300005543 Bacteria 732
10 Ga0070665_100475726 3300005548 Bacteria 1260
11 Ga0068852_101393671 3300005616 Bacteria 723
12 Ga0068864_100157578 3300005618 Bacteria 2062
13 Ga0068861_100140157 3300005719 Bacteria 1973
14 Ga0068870_10319749 3300005840 Bacteria 986
15 Ga0068858_100116004 3300005842 Bacteria 2503
16 Ga0068860_100748520 3300005843 Bacteria 989
17 Ga0075365_10001680 3300006038 Bacteria 10231
18 Ga0075363_100339587 3300006048 Bacteria 876
19 Ga0075364_10005444 3300006051 Bacteria 7397
20 Ga0075364_10212359 3300006051 Bacteria 1312
21 Ga0075362_10005084 3300006177 Bacteria 4783
22 Ga0075367_10001687 3300006178 Bacteria 9655
23 Ga0075367_10215174 3300006178 Bacteria 1202
24 Ga0075367_10843548 3300006178 Bacteria 584
25 Ga0075370_10200234 3300006353 Bacteria 1178
26 Ga0075434_100523599 3300006871 Bacteria 1206
27 Ga0105240_10827806 3300009093 Bacteria 1001
28 Ga0105247_10031072 3300009101 Bacteria 3240
29 Ga0105243_11631166 3300009148 Bacteria 672
30 Ga0105242_12136471 3300009176 Unclassified 604
31 Ga0105248_11632340 3300009177 Bacteria 731
32 Ga0105237_10301590 3300009545 Bacteria 1605
33 Ga0105249_10765086 3300009553 Bacteria 1028
34 Ga0105249_10856353 3300009553 Bacteria 975
35 Ga0105239_10326097 3300010375 Bacteria 1732
36 Ga0105246_10905282 3300011119 Bacteria 791
37 Ga0163162_11273136 3300013306 Bacteria 835
38 Ga0163162_11436542 3300013306 Bacteria 785
39 Ga0157372_11098498 3300013307 Bacteria 920
40 Ga0157375_11307877 3300013308 Bacteria 852
41 Ga0163163_10388555 3300014325 Bacteria 1453
42 Ga0157380_10212820 3300014326 Unclassified 1724
43 Ga0157380_10623909 3300014326 Bacteria 1071
44 Ga0157377_11179772 3300014745 Unclassified 591
45 Ga0157376_10683762 3300014969 Bacteria 1030
46 Ga0163161_10234838 3300017792 Unclassified 1424
47 Ga0213876_10002321 3300021384 Bacteria 11228
48 Ga0207710_10152224 3300025900 Bacteria 1123
49 Ga0207647_10427277 3300025904 Bacteria 744
50 Ga0207649_10428589 3300025920 Bacteria 994
51 Ga0207652_10394238 3300025921 Bacteria 1249
52 Ga0207709_11035184 3300025935 Bacteria 672
53 Ga0207669_10431539 3300025937 Bacteria 1040
54 Ga0207704_11477641 3300025938 Unclassified 583
55 Ga0207691_10370342 3300025940 Bacteria 1224
56 Ga0207667_10231192 3300025949 Bacteria 1893
57 Ga0207712_10031034 3300025961 Bacteria 3596
58 Ga0207712_10260430 3300025961 Bacteria 1406
59 Ga0207703_10144419 3300026035 Bacteria 2068
60 Ga0207708_10251220 3300026075 Bacteria 1425
61 Ga0207648_10136353 3300026089 Bacteria 2162
62 Ga0207676_10219590 3300026095 Bacteria 1692
63 Ga0207675_100269805 3300026118 Bacteria 1651
64 Ga0207683_11096593 3300026121 Unclassified 739
65 Ga0207698_11826753 3300026142 Bacteria 623
66 Ga0209813_10025629 3300027866 Bacteria 1698
67 Ga0268266_10663836 3300028379 Bacteria 1004
68 Ga0268264_10075109 3300028381 Bacteria 2873
69 Ga0268264_10192772 3300028381 Bacteria 1859
70 Ga0268264_10408869 3300028381 Bacteria 1306
71 Ga0265762_1018442 3300030760 Bacteria 1274
72 Ga0307416_101840958 3300032002 Unclassified 709
73 Ga0316574_0367736 3300035398 Bacteria 908
74 Ga0373937_1070189 3300036401 Bacteria 755
75 Ga0436365_0222005 3300039437 Bacteria 15346
76 Ga0436365_0380684 3300039437 Bacteria 2891
77 Ga0436365_0564084 3300039437 Bacteria 9367
78 Ga0436361_1127994 3300039447 Bacteria 1238
79 Ga0436363_0760248 3300039450 Bacteria 1140
80 Ga0436363_1388531 3300039450 Bacteria 854
81 Ga0436362_0777322 3300039453 Bacteria 9511
82 Ga0436362_0967988 3300039453 Unclassified 717
83 Ga0451798_0906719 3300041458 Bacteria 849
84 Ga0451804_0788271 3300041463 Unclassified 846
85 Ga0451845_0700657 3300041501 Bacteria 824
86 Ga0451851_0792997 3300041507 Bacteria 833
87 Ga0451843_1343202 3300041509 Bacteria 809
88 Ga0451853_0992385 3300041512 Bacteria 616
89 Ga0451853_1928873 3300041512 Bacteria 761
90 Ga0451853_3129658 3300041512 Unclassified 703
91 Ga0439435_0039453 3300042436 Bacteria 1316
92 Ga0450918_006679 3300042531 Bacteria 2053
93 Ga0466957_0537302 3300044842 Bacteria 814
94 Ga0495603_0140354 3300046455 Bacteria 1406
95 Ga0495629_0593457 3300046459 Bacteria 741
96 Ga0495653_0007411 3300046463 Bacteria 8986
97 Ga0495594_0196403 3300046499 Bacteria 1150
98 Ga0495608_0123318 3300046511 Bacteria 1661
99 Ga0495618_0010870 3300046514 Bacteria 5511
100 Ga0495628_0010807 3300046516 Bacteria 7732
101 Ga0495640_0115185 3300046533 Bacteria 1752
102 Ga0495667_0156744 3300046559 Bacteria 1465
103 Ga0495634_0179282 3300046642 Bacteria 1327
104 Ga0495658_0027742 3300046683 Bacteria 3050
105 Ga0495624_0696914 3300046690 Bacteria 603
106 Ga0495670_0200750 3300046691 Unclassified 1056
107 Ga0495676_0390656 3300047321 Bacteria 925
108 Ga0495680_0485954 3300047322 Bacteria 840
109 Ga0495675_0172020 3300047444 Bacteria 1330
110 Ga0495684_0007979 3300047471 Bacteria 8181
111 Ga0495686_0005364 3300047472 Bacteria 10135
112 Ga0496105_0055119 3300048908 Bacteria 3283
113 Ga0496108_0016239 3300048911 Bacteria 6070
114 Ga0496108_0124761 3300048911 Bacteria 2210
115 Ga0496109_0619785 3300048912 Bacteria 1018
116 Ga0496110_0013951 3300048913 Bacteria 6658
117 Ga0496110_0097497 3300048913 Bacteria 2634
118 Ga0496111_0066284 3300048914 Bacteria 2622
119 Ga0496111_0155111 3300048914 Bacteria 1699
120 Ga0496111_0331371 3300048914 Bacteria 1127
121 Ga0496113_0890722 3300048916 Bacteria 704
122 Ga0496114_0136760 3300048917 Bacteria 2119
123 Ga0496114_0267748 3300048917 Bacteria 1505
124 Ga0496114_0316509 3300048917 Bacteria 1379
125 Ga0501032_0381770 3300049569 Bacteria 906
126 Ga0501033_0127621 3300049570 Bacteria 1844
127 Ga0501033_0925013 3300049570 Bacteria 585
128 Ga0501034_0009273 3300049571 Bacteria 10317
129 Ga0501034_0041942 3300049571 Bacteria 4631
130 Ga0501036_0101392 3300049572 Bacteria 2435
131 Ga0501039_0242610 3300049575 Bacteria 1417
132 Ga0501041_0037855 3300049577 Unclassified 2924
133 Ga0501041_0681345 3300049577 Unclassified 658
134 Ga0501042_0047745 3300049578 Unclassified 3053
135 Ga0501042_0777573 3300049578 Bacteria 697
136 Ga0501046_0585579 3300049580 Bacteria 793
137 Ga0501072_0022205 3300049588 Bacteria 4924
138 Ga0501072_0171124 3300049588 Bacteria 1733
139 Ga0501072_0873674 3300049588 Bacteria 703
140 Ga0501074_0366693 3300049590 Bacteria 1022
141 Ga0501074_0607306 3300049590 Bacteria 774
142 Ga0501076_1274327 3300049592 Unclassified 605
143 Ga0501080_1005828 3300049742 Bacteria 723
144 Ga0501081_0195132 3300049743 Bacteria 1467
145 Ga0501083_0027256 3300049744 Bacteria 3943
146 Ga0501044_0447917 3300049823 Bacteria 1198
147 Ga0501045_0050334 3300049824 Unclassified 3039
148 nmdc:mga03683_6933_c1 3300050489 Bacteria 3906
149 nmdc:mga03n38_260227_c1 3300050490 Bacteria 919
150 nmdc:mga03n38_389030_c1 3300050490 Bacteria 766
151 nmdc:mga03n38_52111_c1 3300050490 Bacteria 1830
152 nmdc:mga00v17_47628_c1 3300050491 Bacteria 2597
153 nmdc:mga0yw44_1538_c1 3300050492 Bacteria 9224
154 nmdc:mga0yw44_603727_c1 3300050492 Bacteria 745
155 nmdc:mga06z11_325304_c1 3300050494 Bacteria 918
156 nmdc:mga06z11_743700_c1 3300050494 Unclassified 597
157 nmdc:mga04h51_30489_c1 3300050495 Bacteria 1697
158 nmdc:mga08y16_1761092_c1 3300050511 Bacteria 573
159 Ga0495619_0074102 3300053085 Bacteria 2282
160 Ga0501084_0113450 3300054114 Bacteria 2278
161 Ga0501082_0255108 3300060353 Bacteria 1526
162 Ga0501082_0334077 3300060353 Bacteria 1320
163 Ga0451795_0373639
164 Ga0070666_11183175
165 Ga0070661_100445819
166 Ga0070671_100738962
167 Ga0070685_10377379
168 Ga0070685_10745260
169 Ga0070706_100097385
170 Ga0070679_100718269
171 Ga0070672_101024846
172 Ga0070665_100475726
173 Ga0068852_101393671
174 Ga0068864_100157578
175 Ga0068861_100140157
176 Ga0068870_10319749
177 Ga0068858_100116004
178 Ga0068860_100748520
179 Ga0075365_10001680
180 Ga0075363_100339587
181 Ga0075364_10005444
182 Ga0075364_10212359
183 Ga0075362_10005084
184 Ga0075367_10001687
185 Ga0075367_10215174
186 Ga0075367_10843548
187 Ga0075370_10200234
188 Ga0075434_100523599
189 Ga0105240_10827806
190 Ga0105247_10031072
191 Ga0105243_11631166
192 Ga0105242_12136471
193 Ga0105248_11632340
194 Ga0105237_10301590
195 Ga0105249_10765086
196 Ga0105249_10856353
197 Ga0105239_10326097
198 Ga0105246_10905282
199 Ga0163162_11273136
200 Ga0163162_11436542
201 Ga0157372_11098498
202 Ga0157375_11307877
203 Ga0163163_10388555
204 Ga0157380_10212820
205 Ga0157380_10623909
206 Ga0157377_11179772
207 Ga0157376_10683762
208 Ga0163161_10234838
209 Ga0213876_10002321
210 Ga0207710_10152224
211 Ga0207647_10427277
212 Ga0207649_10428589
213 Ga0207652_10394238
214 Ga0207709_11035184
215 Ga0207669_10431539
216 Ga0207704_11477641
217 Ga0207691_10370342
218 Ga0207667_10231192
219 Ga0207712_10031034
220 Ga0207712_10260430
221 Ga0207703_10144419
222 Ga0207708_10251220
223 Ga0207648_10136353
224 Ga0207676_10219590
225 Ga0207675_100269805
226 Ga0207683_11096593
227 Ga0207698_11826753
228 Ga0209813_10025629
229 Ga0268266_10663836
230 Ga0268264_10075109
231 Ga0268264_10192772
232 Ga0268264_10408869
233 Ga0265762_1018442
234 Ga0307416_101840958
235 Ga0316574_0367736
236 Ga0373937_1070189
237 Ga0436365_0222005
238 Ga0436365_0380684
239 Ga0436365_0564084
240 Ga0436361_1127994
241 Ga0436363_0760248
242 Ga0436363_1388531
243 Ga0436362_0777322
244 Ga0436362_0967988
245 Ga0451798_0906719
246 Ga0451804_0788271
247 Ga0451845_0700657
248 Ga0451851_0792997
249 Ga0451843_1343202
250 Ga0451853_0992385
251 Ga0451853_1928873
252 Ga0451853_3129658
253 Ga0439435_0039453
254 Ga0450918_006679
255 Ga0466957_0537302
256 Ga0495603_0140354
257 Ga0495629_0593457
258 Ga0495653_0007411
259 Ga0495594_0196403
260 Ga0495608_0123318
261 Ga0495618_0010870
262 Ga0495628_0010807
263 Ga0495640_0115185
264 Ga0495667_0156744
265 Ga0495634_0179282
266 Ga0495658_0027742
267 Ga0495624_0696914
268 Ga0495670_0200750
269 Ga0495676_0390656
270 Ga0495680_0485954
271 Ga0495675_0172020
272 Ga0495684_0007979
273 Ga0495686_0005364
274 Ga0496105_0055119
275 Ga0496108_0016239
276 Ga0496108_0124761
277 Ga0496109_0619785
278 Ga0496110_0013951
279 Ga0496110_0097497
280 Ga0496111_0066284
281 Ga0496111_0155111
282 Ga0496111_0331371
283 Ga0496113_0890722
284 Ga0496114_0136760
285 Ga0496114_0267748
286 Ga0496114_0316509
287 Ga0501032_0381770
288 Ga0501033_0127621
289 Ga0501033_0925013
290 Ga0501034_0009273
291 Ga0501034_0041942
292 Ga0501036_0101392
293 Ga0501039_0242610
294 Ga0501041_0037855
295 Ga0501041_0681345
296 Ga0501042_0047745
297 Ga0501042_0777573
298 Ga0501046_0585579
299 Ga0501072_0022205
300 Ga0501072_0171124
301 Ga0501072_0873674
302 Ga0501074_0366693
303 Ga0501074_0607306
304 Ga0501076_1274327
305 Ga0501080_1005828
306 Ga0501081_0195132
307 Ga0501083_0027256
308 Ga0501044_0447917
309 Ga0501045_0050334
310 nmdc:mga03683_6933_c1
311 nmdc:mga03n38_260227_c1
312 nmdc:mga03n38_389030_c1
313 nmdc:mga03n38_52111_c1
314 nmdc:mga00v17_47628_c1
315 nmdc:mga0yw44_1538_c1
316 nmdc:mga0yw44_603727_c1
317 nmdc:mga06z11_325304_c1
318 nmdc:mga06z11_743700_c1
319 nmdc:mga04h51_30489_c1
320 nmdc:mga08y16_1761092_c1
321 Ga0495619_0074102
322 Ga0501084_0113450
323 Ga0501082_0255108
324 Ga0501082_0334077

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

26

161

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ldk-assembly1.cif.gz_A solution nmr structure of protein aaur_3427 from arthrobacter aurescens, northeast structural genomics consortium target aar96 0.8599 7 135
3uid-assembly1.cif.gz_A crystal structure of protein ms6760 from mycobacterium smegmatis 0.859 7 138
1xfs-assembly1.cif.gz_A x-ray crystal structure of protein ne0264 from nitrosomonas europaea. northeast structural genomics consortium target ner5. 0.8334 4 139
3pu2-assembly2.cif.gz_B crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.8123 7 119
1xuv-assembly2.cif.gz_B-2 x-ray crystal structure of protein mm0500 from methanosarcina mazei. northeast structural genomics consortium target mar10. 0.808 2 139
ID Description Score Start End Superfamily
2ldkA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8599 7 135 3.30.530.20
af_Q2G1U9_1_155_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8069 1 136 3.30.530.20
3uidB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8025 3 139 3.30.530.20
1xuvB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.786 2 139 3.30.530.20
2ldkA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7859 7 135 3.30.530.20
ID Description Score Start End GO Terms
AF-I4B2R8-F1-model_v4 Activator of Hsp90 ATPase 1 family protein 0.9474 6 139
AF-A0A521RQM0-F1-model_v4 ATPase 0.9363 4 139
AF-A0A5S4X235-F1-model_v4 ATPase 0.9361 2 139
AF-A0A4Q7FAU3-F1-model_v4 ATPase 0.9349 2 139
AF-D0LUP4-F1-model_v4 Activator of Hsp90 ATPase 1 family protein 0.9347 4 139

Map