F239632

General Info

Members Datasets Scaffolds Average Seq Length
162 105 324 195

Family's Representative Sequence

Representative Sequence 3300031712|Ga0265342_10026696|Ga0265342_100266963
Length 220
Sequence MKKLLHTYRPLPNGRGSDSTSEPRPLGSGCRRFGRLVRLACAAMLAASSIPAEDTVLQIDPSHTKVEFTLADVLHTVHGSFLLKRGDLRFDPATGKASGELVVDAASGDSGSGARDRNMHKNVLESARYPEIVFRPDRVEGKVEPRGTSHVGLHGMFSIHGAEHDITLPAVVEAADGQYTAAITFAVPYVQWGMKNPSTLFLRVSDKVEISIHTVARAAR

Samples

Sample ID Description Type Environment
1 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
27 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
28 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
29 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
30 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
33 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
34 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
35 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
36 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
37 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
54 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
55 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
56 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
57 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
58 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
59 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
60 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
61 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
62 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
63 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
64 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
65 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
66 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
67 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
68 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
69 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
70 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
71 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
72 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
73 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
74 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
75 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
76 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
77 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
78 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
79 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
80 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
81 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
82 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
83 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
84 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
85 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
86 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
87 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
88 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
89 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
90 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
91 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
92 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
93 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
94 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
95 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
96 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
97 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
98 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
99 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
100 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
101 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
102 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
103 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
104 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
105 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.38
Metatranscriptomes 0.62
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.23
Rhizosphere 96.91
Stem 0
Stem Tuber 0
Unclassified 25.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265342_10026696 3300031712 Bacteria 3616
2 LJNas_1000003 3300000546 Bacteria 33926
3 Ga0070658_10363817 3300005327 Bacteria 1239
4 Ga0070683_100069443 3300005329 Unclassified 3285
5 Ga0070666_10479810 3300005335 Unclassified 900
6 Ga0070680_100034604 3300005336 Bacteria 4073
7 Ga0070680_100292385 3300005336 Bacteria 1381
8 Ga0070709_10008883 3300005434 Bacteria 5531
9 Ga0070709_10162542 3300005434 Bacteria 1554
10 Ga0070714_100021656 3300005435 Bacteria 5261
11 Ga0070713_100000272 3300005436 Bacteria 34036
12 Ga0070713_100566530 3300005436 Bacteria 1077
13 Ga0070710_10011278 3300005437 Unclassified 4414
14 Ga0070711_100000080 3300005439 Bacteria 53781
15 Ga0070708_100052709 3300005445 Bacteria 3608
16 Ga0070681_10024926 3300005458 Bacteria 6018
17 Ga0070706_100155595 3300005467 Bacteria 2134
18 Ga0070707_100963417 3300005468 Bacteria 818
19 Ga0070679_100132017 3300005530 Unclassified 2478
20 Ga0070672_100541259 3300005543 Unclassified 1010
21 Ga0068855_100013408 3300005563 Bacteria 9884
22 Ga0068856_100013575 3300005614 Bacteria 7885
23 Ga0068852_100072986 3300005616 Bacteria 3018
24 Ga0068852_100089963 3300005616 Bacteria 2744
25 Ga0068863_100248778 3300005841 Unclassified 1717
26 Ga0070717_10015388 3300006028 Bacteria 5909
27 Ga0070717_10023872 3300006028 Unclassified 4852
28 Ga0070716_100099381 3300006173 Unclassified 1780
29 Ga0070716_100298397 3300006173 Unclassified 1120
30 Ga0070712_100000312 3300006175 Bacteria 27347
31 Ga0070712_100426395 3300006175 Unclassified 1100
32 Ga0068871_100127293 3300006358 Bacteria 2157
33 Ga0099794_10037990 3300007265 Bacteria 2281
34 Ga0105248_10046896 3300009177 Bacteria 4845
35 Ga0105248_10967727 3300009177 Unclassified 961
36 Ga0105248_11108396 3300009177 Unclassified 895
37 Ga0105237_10874612 3300009545 Unclassified 905
38 Ga0105237_10988301 3300009545 Unclassified 848
39 Ga0105238_10723880 3300009551 Unclassified 1008
40 Ga0157374_10632649 3300013296 Bacteria 1081
41 Ga0157375_10344876 3300013308 Unclassified 1655
42 Ga0163163_10080893 3300014325 Unclassified 3250
43 Ga0163163_10165647 3300014325 Bacteria 2256
44 Ga0163163_10177119 3300014325 Unclassified 2179
45 Ga0157377_10705163 3300014745 Unclassified 733
46 Ga0157376_10490561 3300014969 Bacteria 1205
47 Ga0213873_10047041 3300021358 Bacteria 1130
48 Ga0213876_10292401 3300021384 Unclassified 866
49 Ga0207692_10007570 3300025898 Unclassified 4452
50 Ga0207699_10006476 3300025906 Bacteria 5673
51 Ga0207699_10325000 3300025906 Bacteria 1080
52 Ga0207705_10281734 3300025909 Bacteria 1273
53 Ga0207684_10012230 3300025910 Bacteria 7471
54 Ga0207684_10334943 3300025910 Bacteria 1303
55 Ga0207707_10063594 3300025912 Bacteria 3212
56 Ga0207693_10000131 3300025915 Bacteria 67893
57 Ga0207663_10010317 3300025916 Bacteria 4967
58 Ga0207652_10042049 3300025921 Bacteria 3888
59 Ga0207652_10246743 3300025921 Bacteria 1610
60 Ga0207646_10324256 3300025922 Bacteria 1392
61 Ga0207700_10000852 3300025928 Bacteria 17553
62 Ga0207700_10063595 3300025928 Unclassified 2807
63 Ga0207664_10131248 3300025929 Unclassified 2109
64 Ga0207665_10008720 3300025939 Bacteria 6670
65 Ga0207665_10301426 3300025939 Unclassified 1198
66 Ga0207667_10058081 3300025949 Bacteria 4059
67 Ga0207702_10053636 3300026078 Bacteria 3414
68 Ga0207641_10063073 3300026088 Bacteria 3165
69 Ga0207698_10070420 3300026142 Bacteria 2771
70 Ga0207698_10920002 3300026142 Unclassified 882
71 Ga0265323_10002592 3300028653 Bacteria 8200
72 Ga0265338_10085230 3300028800 Bacteria 2634
73 Ga0265338_10140483 3300028800 Bacteria 1892
74 Ga0265760_10019318 3300031090 Bacteria 1963
75 Ga0265325_10006085 3300031241 Bacteria 7381
76 Ga0265340_10115946 3300031247 Bacteria 1235
77 Ga0265339_10105284 3300031249 Bacteria 1465
78 Ga0265316_10003613 3300031344 Bacteria 15596
79 Ga0265316_10009499 3300031344 Bacteria 8957
80 Ga0265316_10025534 3300031344 Bacteria 4928
81 Ga0265316_10044550 3300031344 Bacteria 3528
82 Ga0265316_10131552 3300031344 Bacteria 1884
83 Ga0265314_10249968 3300031711 Unclassified 1018
84 Ga0265342_10200882 3300031712 Bacteria 1083
85 Ga0373936_0060260 3300035113 Bacteria 1548
86 Ga0373936_0381651 3300035113 Unclassified 645
87 Ga0373945_0016669 3300035116 Bacteria 2481
88 Ga0373954_0222348 3300035118 Unclassified 929
89 Ga0373943_0001455 3300035170 Bacteria 10702
90 Ga0373943_0187158 3300035170 Bacteria 1141
91 Ga0373955_0102198 3300035172 Bacteria 1647
92 Ga0373935_0124893 3300035692 Bacteria 1723
93 Ga0373935_0449786 3300035692 Bacteria 930
94 Ga0373935_0819664 3300035692 Unclassified 687
95 Ga0373927_0001426 3300035695 Bacteria 18006
96 Ga0373927_0040311 3300035695 Unclassified 3030
97 Ga0373927_0056206 3300035695 Bacteria 2544
98 Ga0373927_0612240 3300035695 Bacteria 720
99 Ga0373947_0044088 3300035725 Bacteria 2665
100 Ga0373947_0238845 3300035725 Unclassified 1199
101 Ga0373937_0034814 3300036401 Bacteria 4581
102 Ga0373937_0176994 3300036401 Unclassified 2003
103 Ga0373937_1342961 3300036401 Bacteria 663
104 Ga0373925_0005404 3300037068 Bacteria 9523
105 Ga0373925_0047988 3300037068 Bacteria 3180
106 Ga0436365_0508217 3300039437 Bacteria 1246
107 Ga0436363_1551903 3300039450 Bacteria 13470
108 Ga0436362_1037003 3300039453 Bacteria 3243
109 Ga0466964_0322117 3300044706 Unclassified 786
110 Ga0495629_0064539 3300046459 Bacteria 2557
111 Ga0495651_0022507 3300046462 Unclassified 4897
112 Ga0495580_0000401 3300046472 Bacteria 35524
113 Ga0495580_0001900 3300046472 Bacteria 18368
114 Ga0495580_0044134 3300046472 Bacteria 3172
115 Ga0495580_0134615 3300046472 Unclassified 1713
116 Ga0495580_0135087 3300046472 Bacteria 1710
117 Ga0495664_0011434 3300046477 Bacteria 5006
118 Ga0495664_0017919 3300046477 Bacteria 4050
119 Ga0495664_0054415 3300046477 Unclassified 2380
120 Ga0495608_0157727 3300046511 Bacteria 1444
121 Ga0495628_0048853 3300046516 Unclassified 3351
122 Ga0495630_0007542 3300046517 Bacteria 7776
123 Ga0495630_0015545 3300046517 Bacteria 5560
124 Ga0495666_0085804 3300046526 Bacteria 1487
125 Ga0495652_0020565 3300046529 Bacteria 5866
126 Ga0495652_0305802 3300046529 Unclassified 1154
127 Ga0495586_0266383 3300046535 Bacteria 979
128 Ga0495587_0140989 3300046536 Bacteria 1376
129 Ga0495645_0002387 3300046543 Bacteria 12746
130 Ga0495645_0140803 3300046543 Bacteria 1683
131 Ga0495645_0441525 3300046543 Unclassified 822
132 Ga0495667_0170938 3300046559 Bacteria 1396
133 Ga0495634_0209846 3300046642 Bacteria 1206
134 Ga0495635_0052191 3300046663 Bacteria 2817
135 Ga0495635_0261083 3300046663 Bacteria 1166
136 Ga0495635_0573863 3300046663 Unclassified 738
137 Ga0495588_0054888 3300046674 Bacteria 2056
138 Ga0495657_0140136 3300046675 Bacteria 1508
139 Ga0495657_0268855 3300046675 Unclassified 1023
140 Ga0495657_0419335 3300046675 Bacteria 786
141 Ga0495599_0009988 3300046678 Bacteria 5810
142 Ga0495623_0079094 3300046679 Bacteria 2038
143 Ga0495623_0087295 3300046679 Bacteria 1922
144 Ga0495646_0297419 3300046680 Bacteria 855
145 Ga0495658_0046253 3300046683 Bacteria 2446
146 Ga0495600_0054572 3300046809 Bacteria 2610
147 Ga0495604_0084258 3300047317 Bacteria 2374
148 Ga0495604_0185627 3300047317 Bacteria 1452
149 Ga0495674_0018969 3300047319 Bacteria 6396
150 Ga0495674_0192131 3300047319 Bacteria 1696
151 Ga0495674_0709949 3300047319 Bacteria 788
152 Ga0495674_0729094 3300047319 Unclassified 776
153 Ga0495680_0022788 3300047322 Bacteria 5215
154 Ga0495675_0078567 3300047444 Bacteria 2078
155 Ga0495675_0187721 3300047444 Bacteria 1263
156 Ga0495675_0216342 3300047444 Bacteria 1161
157 Ga0495684_0039158 3300047471 Bacteria 3634
158 Ga0495684_0097530 3300047471 Bacteria 2224
159 Ga0496112_0153465 3300048915 Bacteria 2270
160 Ga0496115_0043705 3300048918 Bacteria 3573
161 Ga0495601_0020922 3300053077 Bacteria 4000
162 Ga0495619_0119694 3300053085 Bacteria 1805
163 Ga0265342_10026696
164 LJNas_1000003
165 Ga0070658_10363817
166 Ga0070683_100069443
167 Ga0070666_10479810
168 Ga0070680_100034604
169 Ga0070680_100292385
170 Ga0070709_10008883
171 Ga0070709_10162542
172 Ga0070714_100021656
173 Ga0070713_100000272
174 Ga0070713_100566530
175 Ga0070710_10011278
176 Ga0070711_100000080
177 Ga0070708_100052709
178 Ga0070681_10024926
179 Ga0070706_100155595
180 Ga0070707_100963417
181 Ga0070679_100132017
182 Ga0070672_100541259
183 Ga0068855_100013408
184 Ga0068856_100013575
185 Ga0068852_100072986
186 Ga0068852_100089963
187 Ga0068863_100248778
188 Ga0070717_10015388
189 Ga0070717_10023872
190 Ga0070716_100099381
191 Ga0070716_100298397
192 Ga0070712_100000312
193 Ga0070712_100426395
194 Ga0068871_100127293
195 Ga0099794_10037990
196 Ga0105248_10046896
197 Ga0105248_10967727
198 Ga0105248_11108396
199 Ga0105237_10874612
200 Ga0105237_10988301
201 Ga0105238_10723880
202 Ga0157374_10632649
203 Ga0157375_10344876
204 Ga0163163_10080893
205 Ga0163163_10165647
206 Ga0163163_10177119
207 Ga0157377_10705163
208 Ga0157376_10490561
209 Ga0213873_10047041
210 Ga0213876_10292401
211 Ga0207692_10007570
212 Ga0207699_10006476
213 Ga0207699_10325000
214 Ga0207705_10281734
215 Ga0207684_10012230
216 Ga0207684_10334943
217 Ga0207707_10063594
218 Ga0207693_10000131
219 Ga0207663_10010317
220 Ga0207652_10042049
221 Ga0207652_10246743
222 Ga0207646_10324256
223 Ga0207700_10000852
224 Ga0207700_10063595
225 Ga0207664_10131248
226 Ga0207665_10008720
227 Ga0207665_10301426
228 Ga0207667_10058081
229 Ga0207702_10053636
230 Ga0207641_10063073
231 Ga0207698_10070420
232 Ga0207698_10920002
233 Ga0265323_10002592
234 Ga0265338_10085230
235 Ga0265338_10140483
236 Ga0265760_10019318
237 Ga0265325_10006085
238 Ga0265340_10115946
239 Ga0265339_10105284
240 Ga0265316_10003613
241 Ga0265316_10009499
242 Ga0265316_10025534
243 Ga0265316_10044550
244 Ga0265316_10131552
245 Ga0265314_10249968
246 Ga0265342_10200882
247 Ga0373936_0060260
248 Ga0373936_0381651
249 Ga0373945_0016669
250 Ga0373954_0222348
251 Ga0373943_0001455
252 Ga0373943_0187158
253 Ga0373955_0102198
254 Ga0373935_0124893
255 Ga0373935_0449786
256 Ga0373935_0819664
257 Ga0373927_0001426
258 Ga0373927_0040311
259 Ga0373927_0056206
260 Ga0373927_0612240
261 Ga0373947_0044088
262 Ga0373947_0238845
263 Ga0373937_0034814
264 Ga0373937_0176994
265 Ga0373937_1342961
266 Ga0373925_0005404
267 Ga0373925_0047988
268 Ga0436365_0508217
269 Ga0436363_1551903
270 Ga0436362_1037003
271 Ga0466964_0322117
272 Ga0495629_0064539
273 Ga0495651_0022507
274 Ga0495580_0000401
275 Ga0495580_0001900
276 Ga0495580_0044134
277 Ga0495580_0134615
278 Ga0495580_0135087
279 Ga0495664_0011434
280 Ga0495664_0017919
281 Ga0495664_0054415
282 Ga0495608_0157727
283 Ga0495628_0048853
284 Ga0495630_0007542
285 Ga0495630_0015545
286 Ga0495666_0085804
287 Ga0495652_0020565
288 Ga0495652_0305802
289 Ga0495586_0266383
290 Ga0495587_0140989
291 Ga0495645_0002387
292 Ga0495645_0140803
293 Ga0495645_0441525
294 Ga0495667_0170938
295 Ga0495634_0209846
296 Ga0495635_0052191
297 Ga0495635_0261083
298 Ga0495635_0573863
299 Ga0495588_0054888
300 Ga0495657_0140136
301 Ga0495657_0268855
302 Ga0495657_0419335
303 Ga0495599_0009988
304 Ga0495623_0079094
305 Ga0495623_0087295
306 Ga0495646_0297419
307 Ga0495658_0046253
308 Ga0495600_0054572
309 Ga0495604_0084258
310 Ga0495604_0185627
311 Ga0495674_0018969
312 Ga0495674_0192131
313 Ga0495674_0709949
314 Ga0495674_0729094
315 Ga0495680_0022788
316 Ga0495675_0078567
317 Ga0495675_0187721
318 Ga0495675_0216342
319 Ga0495684_0039158
320 Ga0495684_0097530
321 Ga0496112_0153465
322 Ga0496115_0043705
323 Ga0495601_0020922
324 Ga0495619_0119694

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04264

YceI

YceI-like domain

57

216

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ixh-assembly1.cif.gz_A crystal structure of burkholderia cenocepacia bcna 0.8136 27 184
5ixh-assembly1.cif.gz_A crystal structure of burkholderia cenocepacia bcna 0.7992 27 184
5w2d-assembly1.cif.gz_A crystal structure of mutant cj ycei protein (cj-g34c) for nanotechnology applications 0.7946 39 185
5w17-assembly1.cif.gz_A crystal structure of campylobacter jejuni ycei protein that crystallizes with large solvent channels for nanotechnology applications 0.7943 39 185
5w2x-assembly1.cif.gz_A crystal structure of mutant cj ycei protein (cj-n48c) for nanotechnology applications 0.7942 39 185
ID Description Score Start End Superfamily
5w2dA01 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.8046 42 185 2.40.128.110
1wubA00 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.7843 24 188 2.40.128.110
af_P0A8X2_23_191_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.7781 24 185 2.40.128.110
af_O07742_26_201_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.7706 26 185 2.40.128.110
5w2dA01 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.7701 42 185 2.40.128.110
ID Description Score Start End GO Terms
AF-A0A1Q7KY46-F1-model_v4 Lipid/polyisoprenoid-binding YceI-like domain-containing protein 0.9825 35 185
AF-A0A2V9D059-F1-model_v4 Lipid/polyisoprenoid-binding YceI-like domain-containing protein 0.9818 15 189
AF-A0A386C7L8-F1-model_v4 YceI family protein 0.9614 58 185
AF-A0A2Z5G6U7-F1-model_v4 Lipid/polyisoprenoid-binding YceI-like domain-containing protein 0.9577 10 186
AF-A0A845TX76-F1-model_v4 YceI family protein 0.9573 15 189

Map