F239574

General Info

Members Datasets Scaffolds Average Seq Length
162 116 162 163

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10557946|Ga0265338_105579462
Length 156
Sequence MASNRHLGRIVALQTLYEQDFRREVGDTNLVLDEVLERNIARYQETIDDKEFIENLVHGVNTHEQELDDVIRPVAPEWPIDQIARMDRMVLHIGVYELLYDDGKVPPKVVINEAVELAKAFGGDNSSKFVNGVLGTILREKEAKPAKAKKTPKAKN

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
31 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
68 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
72 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
73 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
74 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
75 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
76 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
77 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
78 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
79 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
80 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
81 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
82 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
83 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
86 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
87 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
88 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
89 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
90 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
91 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
92 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
93 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
94 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
95 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
96 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
97 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
98 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
99 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
100 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
101 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
102 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
103 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
104 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
105 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
106 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
107 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
108 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
109 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
110 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
111 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
112 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
113 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
114 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
115 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
116 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.31
Nodule 0
Rhizoplane 0
Rhizosphere 72.22
Stem 0
Stem Tuber 0
Unclassified 2.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000226 3300001915 Bacteria 16876
2 JGI24740J21852_10005605 3300001979 Bacteria 5288
3 rootH2_10000244 3300003320 Bacteria 697651
4 rootH2_10204262 3300003320 Bacteria 3384
5 rootH2_10206709 3300003320 Unclassified 1173
6 rootH1_10226882 3300003323 Unclassified 1140
7 Ga0070676_10239783 3300005328 Bacteria 1205
8 Ga0070683_100000112 3300005329 Bacteria 53123
9 Ga0070683_100428918 3300005329 Bacteria 1261
10 Ga0068869_100169586 3300005334 Bacteria 1704
11 Ga0070680_100092015 3300005336 Unclassified 2511
12 Ga0070682_100015931 3300005337 Bacteria 4365
13 Ga0070661_100579619 3300005344 Unclassified 905
14 Ga0070668_101565544 3300005347 Unclassified 603
15 Ga0070675_100721618 3300005354 Unclassified 908
16 Ga0070671_100228642 3300005355 Bacteria 1578
17 Ga0070674_100005409 3300005356 Bacteria 7373
18 Ga0070667_100281074 3300005367 Bacteria 1494
19 Ga0070663_100288783 3300005455 Bacteria 1309
20 Ga0070678_100003010 3300005456 Bacteria 9340
21 Ga0070685_10003963 3300005466 Bacteria 7482
22 Ga0070684_100000049 3300005535 Bacteria 79768
23 Ga0070686_100031217 3300005544 Unclassified 3255
24 Ga0070686_100440167 3300005544 Bacteria 1000
25 Ga0070696_100327794 3300005546 Unclassified 1180
26 Ga0068855_100082181 3300005563 Bacteria 3734
27 Ga0068860_100013616 3300005843 Bacteria 7972
28 Ga0068862_100134154 3300005844 Bacteria 2193
29 Ga0075368_10000065 3300006042 Bacteria 25604
30 Ga0075363_100000022 3300006048 Bacteria 32445
31 Ga0075363_100112350 3300006048 Bacteria 1515
32 Ga0075364_10064884 3300006051 Unclassified 2397
33 Ga0075362_10000063 3300006177 Bacteria 31783
34 Ga0075367_10025939 3300006178 Unclassified 3318
35 Ga0075369_10000010 3300006186 Bacteria 77564
36 Ga0075369_10077515 3300006186 Unclassified 1470
37 Ga0075366_10000001 3300006195 Bacteria 569172
38 Ga0075366_10000138 3300006195 Bacteria 30666
39 Ga0075366_10001938 3300006195 Bacteria 10463
40 Ga0075366_10019344 3300006195 Bacteria 3939
41 Ga0075370_10000462 3300006353 Bacteria 15151
42 Ga0075370_10107490 3300006353 Bacteria 1618
43 Ga0105240_10163575 3300009093 Bacteria 2641
44 Ga0105240_10380677 3300009093 Bacteria 1594
45 Ga0111539_11144516 3300009094 Unclassified 904
46 Ga0105245_10006834 3300009098 Bacteria 10007
47 Ga0105245_11683162 3300009098 Unclassified 687
48 Ga0105243_10032209 3300009148 Unclassified 4048
49 Ga0105241_10000003 3300009174 Bacteria 839043
50 Ga0105241_10294329 3300009174 Bacteria 1391
51 Ga0105241_10589739 3300009174 Bacteria 1003
52 Ga0105248_11158826 3300009177 Bacteria 874
53 Ga0105238_10387220 3300009551 Bacteria 1390
54 Ga0105238_11176176 3300009551 Unclassified 791
55 Ga0105249_10036763 3300009553 Unclassified 4443
56 Ga0105249_10484046 3300009553 Bacteria 1281
57 Ga0157371_10003755 3300013102 Bacteria 13592
58 Ga0157370_10224206 3300013104 Bacteria 1740
59 Ga0157369_10138037 3300013105 Bacteria 2580
60 Ga0157369_10262848 3300013105 Bacteria 1800
61 Ga0157374_10412346 3300013296 Bacteria 1349
62 Ga0163162_10829683 3300013306 Bacteria 1041
63 Ga0157372_10530249 3300013307 Bacteria 1373
64 Ga0157377_10001177 3300014745 Bacteria 11110
65 Ga0157379_11981533 3300014968 Unclassified 575
66 Ga0207645_10236498 3300025907 Bacteria 1206
67 Ga0207654_10000002 3300025911 Bacteria 1460142
68 Ga0207654_10070977 3300025911 Bacteria 2069
69 Ga0207654_10352654 3300025911 Bacteria 1013
70 Ga0207695_10771788 3300025913 Unclassified 841
71 Ga0207657_10003611 3300025919 Bacteria 16490
72 Ga0207652_10533987 3300025921 Unclassified 1055
73 Ga0207652_11057375 3300025921 Unclassified 711
74 Ga0207694_10394356 3300025924 Unclassified 1150
75 Ga0207687_10095025 3300025927 Bacteria 2182
76 Ga0207687_10947354 3300025927 Unclassified 737
77 Ga0207644_11321391 3300025931 Bacteria 606
78 Ga0207690_10000527 3300025932 Bacteria 24894
79 Ga0207709_10049943 3300025935 Unclassified 2555
80 Ga0207669_10006666 3300025937 Bacteria 5292
81 Ga0207689_10209541 3300025942 Bacteria 1610
82 Ga0207661_10000077 3300025944 Bacteria 67190
83 Ga0207661_10709514 3300025944 Bacteria 925
84 Ga0207667_10000003 3300025949 Bacteria 822935
85 Ga0207667_10000060 3300025949 Bacteria 192320
86 Ga0207667_10070739 3300025949 Bacteria 3631
87 Ga0207667_10280915 3300025949 Bacteria 1701
88 Ga0207712_10003874 3300025961 Bacteria 9451
89 Ga0207712_10572852 3300025961 Unclassified 973
90 Ga0207668_11400137 3300025972 Unclassified 630
91 Ga0207674_10000001 3300026116 Bacteria 616581
92 Ga0207674_10067071 3300026116 Bacteria 3613
93 Ga0207675_100854889 3300026118 Unclassified 925
94 Ga0209813_10000001 3300027866 Bacteria 280406
95 Ga0268266_10021620 3300028379 Bacteria 5480
96 Ga0268265_10293601 3300028380 Unclassified 1460
97 Ga0268264_10455585 3300028381 Bacteria 1240
98 Ga0265337_1004925 3300028556 Bacteria 5434
99 Ga0265337_1007142 3300028556 Bacteria 4214
100 Ga0265326_10001740 3300028558 Bacteria 7533
101 Ga0265334_10000115 3300028573 Bacteria 52649
102 Ga0265334_10002006 3300028573 Bacteria 9646
103 Ga0265322_10015050 3300028654 Bacteria 2237
104 Ga0265322_10017267 3300028654 Bacteria 2079
105 Ga0265322_10060624 3300028654 Bacteria 1073
106 Ga0265336_10000424 3300028666 Bacteria 26224
107 Ga0265338_10000003 3300028800 Bacteria 733923
108 Ga0265338_10000039 3300028800 Bacteria 236135
109 Ga0265338_10007299 3300028800 Bacteria 13788
110 Ga0265338_10053135 3300028800 Unclassified 3628
111 Ga0265338_10377828 3300028800 Unclassified 1014
112 Ga0265338_10452441 3300028800 Unclassified 909
113 Ga0265338_10557946 3300028800 Unclassified 801
114 Ga0265325_10025424 3300031241 Bacteria 3216
115 Ga0265339_10156924 3300031249 Bacteria 1147
116 Ga0265327_10012174 3300031251 Bacteria 5835
117 Ga0265316_10003176 3300031344 Bacteria 16712
118 Ga0265316_10199851 3300031344 Unclassified 1482
119 Ga0265313_10163179 3300031595 Unclassified 945
120 Ga0265314_10158290 3300031711 Bacteria 1381
121 Ga0265314_10423270 3300031711 Unclassified 715
122 Ga0265342_10232901 3300031712 Unclassified 989
123 Ga0395900_0105902 3300037418 Bacteria 2889
124 Ga0395898_0713943 3300037466 Unclassified 944
125 Ga0495582_0056117 3300046473 Bacteria 2171
126 Ga0495609_0030834 3300046538 Bacteria 2441
127 Ga0495622_0000502 3300046557 Bacteria 24435
128 Ga0495635_0336805 3300046663 Bacteria 1008
129 Ga0495658_0000641 3300046683 Bacteria 18915
130 Ga0495671_0194206 3300046692 Bacteria 985
131 Ga0495600_0008925 3300046809 Bacteria 6175
132 Ga0495677_0191919 3300047445 Bacteria 793
133 Ga0495602_0449951 3300048088 Bacteria 909
134 Ga0501073_0076734 3300049589 Unclassified 2325
135 Ga0501080_0000520 3300049742 Bacteria 30275
136 nmdc:mga03683_80_c1 3300050489 Bacteria 35991
137 nmdc:mga03n38_126456_c1 3300050490 Unclassified 1262
138 nmdc:mga03n38_142_c1 3300050490 Bacteria 15721
139 nmdc:mga00v17_56476_c1 3300050491 Unclassified 2400
140 nmdc:mga0yw44_21337_c1 3300050492 Bacteria 3611
141 nmdc:mga0yw44_2_c1 3300050492 Bacteria 586884
142 nmdc:mga0k408_13_c1 3300050493 Bacteria 48149
143 nmdc:mga0k408_214_c1 3300050493 Bacteria 31125
144 nmdc:mga0k408_2889_c1 3300050493 Bacteria 9112
145 nmdc:mga06z11_15_c1 3300050494 Bacteria 82672
146 nmdc:mga04h51_1_c1 3300050495 Bacteria 273320
147 nmdc:mga07m45_200704_c1 3300050496 Bacteria 1160
148 nmdc:mga07m45_5621_c1 3300050496 Bacteria 6264
149 nmdc:mga08y16_5295_c1 3300050511 Bacteria 13491
150 nmdc:mga0sz30_1_c1 3300050516 Bacteria 796501
151 nmdc:mga0sz30_3_c9 3300050516 Bacteria 81468
152 nmdc:mga0sz30_71794_c1 3300050516 Unclassified 1491
153 Ga0500643_000022 3300053087 Bacteria 277519
154 Ga0500644_0001037 3300053088 Bacteria 8346
155 Ga0500566_0000001 3300053094 Bacteria 1101031
156 Ga0500614_025688 3300053123 Unclassified 1402
157 Ga0500628_000028 3300053129 Bacteria 59993
158 Ga0500559_0006860 3300053136 Bacteria 5104
159 Ga0500561_0000001 3300053137 Bacteria 957685
160 Ga0500577_0000528 3300053142 Bacteria 9883
161 Ga0500570_000006 3300053724 Bacteria 129824
162 Ga0500611_004452 3300053727 Bacteria 1891

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009093 Ga0105240_10380677 Ga0105240_103806773 147
2 3300005456 Ga0070678_100003010 Ga0070678_10000301016 153
3 3300013307 Ga0157372_10530249 Ga0157372_105302492 153
4 3300009174 Ga0105241_10000003 Ga0105241_10000003346 154
5 3300013105 Ga0157369_10262848 Ga0157369_102628483 154
6 3300025911 Ga0207654_10000002 Ga0207654_10000002861 154
7 3300025919 Ga0207657_10003611 Ga0207657_100036115 154
8 3300025932 Ga0207690_10000527 Ga0207690_1000052718 154
9 3300025949 Ga0207667_10000060 Ga0207667_10000060175 154
10 3300026116 Ga0207674_10000001 Ga0207674_10000001577 154
11 3300028800 Ga0265338_10452441 Ga0265338_104524412 154
12 3300049589 Ga0501073_0076734 Ga0501073_0076734_1611_2075 154
13 3300049742 Ga0501080_0000520 Ga0501080_0000520_25934_26398 154
14 3300005347 Ga0070668_101565544 Ga0070668_1015655441 155
15 3300005355 Ga0070671_100228642 Ga0070671_1002286423 155
16 3300006177 Ga0075362_10000063 Ga0075362_1000006321 155
17 3300006186 Ga0075369_10077515 Ga0075369_100775153 155
18 3300009177 Ga0105248_11158826 Ga0105248_111588262 155
19 3300013105 Ga0157369_10138037 Ga0157369_101380373 155
20 3300025911 Ga0207654_10070977 Ga0207654_100709771 155
21 3300025921 Ga0207652_10533987 Ga0207652_105339873 155
22 3300025949 Ga0207667_10000003 Ga0207667_1000000349 155
23 3300025972 Ga0207668_11400137 Ga0207668_114001371 155
24 3300028800 Ga0265338_10557946 Ga0265338_105579462 155
25 3300037418 Ga0395900_0105902 Ga0395900_0105902_2146_2613 155
26 3300037466 Ga0395898_0713943 Ga0395898_0713943_38_505 155
27 3300050489 nmdc:mga03683_80_c1 nmdc:mga03683_80_c1_18810_19328 155
28 3300050516 nmdc:mga0sz30_71794_c1 nmdc:mga0sz30_71794_c1_680_1147 155
29 3300053087 Ga0500643_000022 Ga0500643_000022_90460_90927 155
30 3300053137 Ga0500561_0000001 Ga0500561_0000001_723205_723675 155
31 3300003320 rootH2_10204262 rootH2_102042622 156
32 3300003323 rootH1_10226882 rootH1_102268823 156
33 3300005356 Ga0070674_100005409 Ga0070674_1000054093 156
34 3300005466 Ga0070685_10003963 Ga0070685_100039634 156
35 3300005844 Ga0068862_100134154 Ga0068862_1001341543 156
36 3300006051 Ga0075364_10064884 Ga0075364_100648843 156
37 3300006195 Ga0075366_10001938 Ga0075366_1000193814 156
38 3300006195 Ga0075366_10019344 Ga0075366_100193444 156
39 3300009553 Ga0105249_10484046 Ga0105249_104840463 156
40 3300013296 Ga0157374_10412346 Ga0157374_104123464 156
41 3300025921 Ga0207652_11057375 Ga0207652_110573752 156
42 3300025937 Ga0207669_10006666 Ga0207669_100066669 156
43 3300028379 Ga0268266_10021620 Ga0268266_100216206 156
44 3300028380 Ga0268265_10293601 Ga0268265_102936012 156
45 3300028573 Ga0265334_10002006 Ga0265334_100020064 156
46 3300028654 Ga0265322_10015050 Ga0265322_100150503 156
47 3300028666 Ga0265336_10000424 Ga0265336_1000042417 156
48 3300028800 Ga0265338_10000039 Ga0265338_10000039150 156
49 3300028800 Ga0265338_10377828 Ga0265338_103778281 156
50 3300031241 Ga0265325_10025424 Ga0265325_100254244 156
51 3300031344 Ga0265316_10199851 Ga0265316_101998512 156
52 3300031595 Ga0265313_10163179 Ga0265313_101631791 156
53 3300031712 Ga0265342_10232901 Ga0265342_102329011 156
54 3300050491 nmdc:mga00v17_56476_c1 nmdc:mga00v17_56476_c1_608_1078 156
55 3300050492 nmdc:mga0yw44_21337_c1 nmdc:mga0yw44_21337_c1_1597_2067 156
56 3300050493 nmdc:mga0k408_214_c1 nmdc:mga0k408_214_c1_2698_3168 156
57 3300050493 nmdc:mga0k408_2889_c1 nmdc:mga0k408_2889_c1_2108_2584 156
58 3300005337 Ga0070682_100015931 Ga0070682_1000159313 157
59 3300005544 Ga0070686_100440167 Ga0070686_1004401671 157
60 3300005546 Ga0070696_100327794 Ga0070696_1003277942 157
61 3300005563 Ga0068855_100082181 Ga0068855_1000821813 157
62 3300009093 Ga0105240_10163575 Ga0105240_101635753 157
63 3300009174 Ga0105241_10294329 Ga0105241_102943292 157
64 3300009551 Ga0105238_11176176 Ga0105238_111761761 157
65 3300013104 Ga0157370_10224206 Ga0157370_102242063 157
66 3300025913 Ga0207695_10771788 Ga0207695_107717882 157
67 3300025944 Ga0207661_10709514 Ga0207661_107095142 157
68 3300025949 Ga0207667_10070739 Ga0207667_100707392 157
69 3300026116 Ga0207674_10067071 Ga0207674_100670716 157
70 3300026118 Ga0207675_100854889 Ga0207675_1008548892 157
71 3300028800 Ga0265338_10053135 Ga0265338_100531355 157
72 3300050492 nmdc:mga0yw44_2_c1 nmdc:mga0yw44_2_c1_80932_81489 157
73 3300050511 nmdc:mga08y16_5295_c1 nmdc:mga08y16_5295_c1_6701_7174 157
74 3300005329 Ga0070683_100428918 Ga0070683_1004289182 158
75 3300005455 Ga0070663_100288783 Ga0070663_1002887832 158
76 3300005544 Ga0070686_100031217 Ga0070686_1000312175 158
77 3300006353 Ga0075370_10107490 Ga0075370_101074902 158
78 3300009098 Ga0105245_10006834 Ga0105245_100068345 158
79 3300013102 Ga0157371_10003755 Ga0157371_1000375514 158
80 3300014968 Ga0157379_11981533 Ga0157379_119815331 158
81 3300025924 Ga0207694_10394356 Ga0207694_103943563 158
82 3300025927 Ga0207687_10095025 Ga0207687_100950252 158
83 3300025931 Ga0207644_11321391 Ga0207644_113213911 158
84 3300025949 Ga0207667_10280915 Ga0207667_102809152 158
85 3300028556 Ga0265337_1004925 Ga0265337_10049255 158
86 3300028556 Ga0265337_1007142 Ga0265337_10071422 158
87 3300028558 Ga0265326_10001740 Ga0265326_100017407 158
88 3300028573 Ga0265334_10000115 Ga0265334_1000011512 158
89 3300028654 Ga0265322_10017267 Ga0265322_100172673 158
90 3300028654 Ga0265322_10060624 Ga0265322_100606242 158
91 3300028800 Ga0265338_10000003 Ga0265338_10000003349 158
92 3300028800 Ga0265338_10007299 Ga0265338_1000729910 158
93 3300031249 Ga0265339_10156924 Ga0265339_101569241 158
94 3300031251 Ga0265327_10012174 Ga0265327_100121743 158
95 3300031344 Ga0265316_10003176 Ga0265316_100031766 158
96 3300031711 Ga0265314_10158290 Ga0265314_101582902 158
97 3300031711 Ga0265314_10423270 Ga0265314_104232701 158
98 3300050496 nmdc:mga07m45_200704_c1 nmdc:mga07m45_200704_c1_530_1024 158
99 3300009148 Ga0105243_10032209 Ga0105243_100322095 159
100 3300025935 Ga0207709_10049943 Ga0207709_100499433 159
101 3300046538 Ga0495609_0030834 Ga0495609_0030834_701_1198 159
102 3300047445 Ga0495677_0191919 Ga0495677_0191919_136_615 159
103 3300053724 Ga0500570_000006 Ga0500570_000006_100048_100527 159
104 3300009174 Ga0105241_10589739 Ga0105241_105897392 161
105 3300009551 Ga0105238_10387220 Ga0105238_103872201 161
106 3300025911 Ga0207654_10352654 Ga0207654_103526541 161
107 3300003320 rootH2_10000244 rootH2_10000244539 162
108 3300005329 Ga0070683_100000112 Ga0070683_1000001123 162
109 3300005344 Ga0070661_100579619 Ga0070661_1005796191 162
110 3300005354 Ga0070675_100721618 Ga0070675_1007216182 162
111 3300005535 Ga0070684_100000049 Ga0070684_1000000493 162
112 3300009094 Ga0111539_11144516 Ga0111539_111445162 162
113 3300009553 Ga0105249_10036763 Ga0105249_100367634 162
114 3300013306 Ga0163162_10829683 Ga0163162_108296832 162
115 3300025944 Ga0207661_10000077 Ga0207661_1000007755 162
116 3300025961 Ga0207712_10003874 Ga0207712_1000387413 162
117 3300053129 Ga0500628_000028 Ga0500628_000028_29823_30332 162
118 3300005328 Ga0070676_10239783 Ga0070676_102397831 163
119 3300025907 Ga0207645_10236498 Ga0207645_102364981 163
120 3300046692 Ga0495671_0194206 Ga0495671_0194206_217_729 163
121 3300053088 Ga0500644_0001037 Ga0500644_0001037_4301_4813 163
122 3300053142 Ga0500577_0000528 Ga0500577_0000528_7995_8507 163
123 3300053727 Ga0500611_004452 Ga0500611_004452_557_1069 163
124 3300005334 Ga0068869_100169586 Ga0068869_1001695861 164
125 3300006048 Ga0075363_100112350 Ga0075363_1001123503 164
126 3300006186 Ga0075369_10000010 Ga0075369_100000107 164
127 3300006195 Ga0075366_10000001 Ga0075366_10000001562 164
128 3300025942 Ga0207689_10209541 Ga0207689_102095413 164
129 3300046473 Ga0495582_0056117 Ga0495582_0056117_534_1052 164
130 3300046557 Ga0495622_0000502 Ga0495622_0000502_22715_23233 164
131 3300046663 Ga0495635_0336805 Ga0495635_0336805_422_940 164
132 3300046683 Ga0495658_0000641 Ga0495658_0000641_10721_11239 164
133 3300046809 Ga0495600_0008925 Ga0495600_0008925_1529_2047 164
134 3300048088 Ga0495602_0449951 Ga0495602_0449951_345_863 164
135 3300050490 nmdc:mga03n38_126456_c1 nmdc:mga03n38_126456_c1_313_822 164
136 3300050516 nmdc:mga0sz30_3_c9 nmdc:mga0sz30_3_c9_73468_74019 164
137 3300053094 Ga0500566_0000001 Ga0500566_0000001_526224_526742 164
138 3300053123 Ga0500614_025688 Ga0500614_025688_45_563 164
139 3300053136 Ga0500559_0006860 Ga0500559_0006860_2531_3049 164
140 3300009098 Ga0105245_11683162 Ga0105245_116831621 165
141 3300025927 Ga0207687_10947354 Ga0207687_109473541 165
142 3300025961 Ga0207712_10572852 Ga0207712_105728521 165
143 3300001915 JGI24741J21665_1000226 JGI24741J21665_10002266 166
144 3300001979 JGI24740J21852_10005605 JGI24740J21852_100056054 166
145 3300003320 rootH2_10206709 rootH2_102067092 166
146 3300005336 Ga0070680_100092015 Ga0070680_1000920153 166
147 3300005367 Ga0070667_100281074 Ga0070667_1002810742 166
148 3300005843 Ga0068860_100013616 Ga0068860_1000136163 166
149 3300006042 Ga0075368_10000065 Ga0075368_1000006524 166
150 3300006048 Ga0075363_100000022 Ga0075363_10000002234 166
151 3300006178 Ga0075367_10025939 Ga0075367_100259394 166
152 3300006195 Ga0075366_10000138 Ga0075366_1000013838 166
153 3300006353 Ga0075370_10000462 Ga0075370_1000046217 166
154 3300014745 Ga0157377_10001177 Ga0157377_1000117715 166
155 3300027866 Ga0209813_10000001 Ga0209813_10000001283 166
156 3300028381 Ga0268264_10455585 Ga0268264_104555852 166
157 3300050490 nmdc:mga03n38_142_c1 nmdc:mga03n38_142_c1_3303_3833 166
158 3300050493 nmdc:mga0k408_13_c1 nmdc:mga0k408_13_c1_18136_18696 166
159 3300050494 nmdc:mga06z11_15_c1 nmdc:mga06z11_15_c1_8115_8645 166
160 3300050495 nmdc:mga04h51_1_c1 nmdc:mga04h51_1_c1_257800_258330 166
161 3300050496 nmdc:mga07m45_5621_c1 nmdc:mga07m45_5621_c1_349_879 166
162 3300050516 nmdc:mga0sz30_1_c1 nmdc:mga0sz30_1_c1_67891_68436 166

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01029

NusB

NusB family

6

139

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3imq-assembly1.cif.gz_A crystal structure of the nusb101-s10(delta loop) complex 0.9244 6 144
1tzx-assembly2.cif.gz_B t. maritima nusb, p3221 0.924 5 139
4eya-assembly1.cif.gz_A crystal structure of a plectonemic rna supercoil 0.9185 4 140
5lm7-assembly2.cif.gz_D crystal structure of the lambda n-nus factor complex 0.9125 5 139
3r2d-assembly1.cif.gz_A crystal structure of antitermination factors nusb and nuse in complex with dsrna 0.9087 1 139
ID Description Score Start End Superfamily
af_P0A780_1_139_1.10.940.10 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.9448 6 139 1.10.940.10
af_Q2FY45_1_129_1.10.940.10 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.9357 5 136 1.10.940.10
1tztA00 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.9221 5 139 1.10.940.10
3r2cB00 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.9192 4 139 1.10.940.10
4eyaA00 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.9185 4 140 1.10.940.10
ID Description Score Start End GO Terms
AF-A0A521GMP9-F1-model_v4 Transcription antitermination protein NusB (Antitermination factor NusB) 0.9937 1 139 GO:0003723
GO:0005829
GO:0006353
GO:0031564
AF-A0A1F7QSI4-F1-model_v4 Transcription antitermination protein NusB (Antitermination factor NusB) 0.9937 1 142 GO:0003723
GO:0005829
GO:0006353
GO:0031564
AF-A0A1F7RAK2-F1-model_v4 Transcription antitermination protein NusB (Antitermination factor NusB) 0.9899 1 142 GO:0003723
GO:0005829
GO:0006353
GO:0031564
AF-A0A258GB26-F1-model_v4 Transcription antitermination protein NusB (Antitermination factor NusB) 0.9882 1 137 GO:0003723
GO:0005829
GO:0006353
GO:0031564
AF-A0A1F7R6K1-F1-model_v4 N utilization substance protein B 0.9861 1 111 GO:0003723
GO:0031564

Feature Viewer

pLDDT pTM Quality
87.25 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map