F238431

General Info

Members Datasets Scaffolds Average Seq Length
162 119 162 170

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100104719|Ga0070683_1001047193
Length 187
Sequence VKSYLLELFVAKVLDYQVGLAMSNASGLLDTLLDSWHRNNTILINLLRAIPKAGLEVKAMQGSPSVAELFGHIHYVRLVFVSEDAPELAVDVPEKEWVAEPDPERMAQLLNSSAKAVREAVKSRVEAGRGMDIHYDHPILFLQHMIWHEGYHHGQIKLALKLSGQPMSNEEAGPLTWRVWMNKTKNK

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
20 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
24 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
49 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
67 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
68 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
70 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
71 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
72 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
73 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
74 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
75 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
76 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
77 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
78 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
79 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
80 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
81 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
82 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
83 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
84 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
85 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
86 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
87 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
88 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
89 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
90 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
91 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
92 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
93 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
94 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
95 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
96 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
97 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
98 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
99 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
100 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
101 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
102 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
103 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
104 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
105 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
106 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
107 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
108 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
109 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
110 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
111 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
112 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
113 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
114 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
115 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
116 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
117 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
118 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
119 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.94
Nodule 0
Rhizoplane 2.47
Rhizosphere 90.74
Stem 0
Stem Tuber 0
Unclassified 1.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10171567 3300003320 Bacteria 1376
2 Ga0070683_100104719 3300005329 Bacteria 2666
3 Ga0070680_100332726 3300005336 Bacteria 1290
4 Ga0068868_100148229 3300005338 Bacteria 1931
5 Ga0070714_100000092 3300005435 Bacteria 76129
6 Ga0070714_100451668 3300005435 Bacteria 1221
7 Ga0070713_100070408 3300005436 Bacteria 2953
8 Ga0070713_100396907 3300005436 Bacteria 1287
9 Ga0070713_100901194 3300005436 Bacteria 851
10 Ga0070711_100015117 3300005439 Bacteria 4879
11 Ga0070711_100017789 3300005439 Bacteria 4529
12 Ga0070708_100124145 3300005445 Bacteria 2385
13 Ga0070708_101017599 3300005445 Bacteria 777
14 Ga0070681_10067927 3300005458 Bacteria 3532
15 Ga0070707_100054929 3300005468 Unclassified 3818
16 Ga0070684_100020026 3300005535 Bacteria 5546
17 Ga0070697_101122200 3300005536 Bacteria 700
18 Ga0068853_100027642 3300005539 Bacteria 4766
19 Ga0068853_100049597 3300005539 Bacteria 3608
20 Ga0070693_100027112 3300005547 Bacteria 3100
21 Ga0070693_100192415 3300005547 Bacteria 1320
22 Ga0070665_100003673 3300005548 Bacteria 16264
23 Ga0070665_100048420 3300005548 Bacteria 4268
24 Ga0068854_100066986 3300005578 Bacteria 2615
25 Ga0068854_100255795 3300005578 Bacteria 1400
26 Ga0068856_100366055 3300005614 Bacteria 1460
27 Ga0068856_100803704 3300005614 Unclassified 960
28 Ga0068859_100311765 3300005617 Unclassified 1667
29 Ga0068866_10275959 3300005718 Bacteria 1039
30 Ga0068851_10252734 3300005834 Bacteria 1000
31 Ga0068851_10699326 3300005834 Unclassified 624
32 Ga0070717_10855644 3300006028 Bacteria 827
33 Ga0075365_10037926 3300006038 Bacteria 3129
34 Ga0075368_10416056 3300006042 Unclassified 592
35 Ga0070716_100204660 3300006173 Bacteria 1314
36 Ga0070716_100753248 3300006173 Bacteria 749
37 Ga0070712_100085347 3300006175 Bacteria 2298
38 Ga0070712_100425772 3300006175 Bacteria 1101
39 Ga0075366_10041937 3300006195 Bacteria 2710
40 Ga0097621_100254050 3300006237 Bacteria 1540
41 Ga0075428_100308964 3300006844 Bacteria 1700
42 Ga0075428_100977675 3300006844 Bacteria 896
43 Ga0075431_100216485 3300006847 Unclassified 1955
44 Ga0075431_100271443 3300006847 Unclassified 1718
45 Ga0075433_10247499 3300006852 Bacteria 1582
46 Ga0075434_100065568 3300006871 Bacteria 3617
47 Ga0075434_101187569 3300006871 Bacteria 775
48 Ga0097620_100311742 3300006931 Unclassified 1667
49 Ga0075435_100050364 3300007076 Bacteria 3351
50 Ga0105240_10012391 3300009093 Bacteria 11776
51 Ga0105240_10153065 3300009093 Bacteria 2745
52 Ga0105240_10223174 3300009093 Bacteria 2194
53 Ga0111539_10274650 3300009094 Unclassified 1961
54 Ga0105245_10001306 3300009098 Bacteria 22508
55 Ga0105247_10066255 3300009101 Unclassified 2248
56 Ga0105241_10641862 3300009174 Unclassified 963
57 Ga0105237_10800299 3300009545 Bacteria 949
58 Ga0105237_11050018 3300009545 Bacteria 821
59 Ga0105238_10037638 3300009551 Bacteria 4917
60 Ga0105238_10069535 3300009551 Bacteria 3521
61 Ga0105249_10043258 3300009553 Unclassified 4097
62 Ga0105249_10948819 3300009553 Bacteria 928
63 Ga0105239_10292628 3300010375 Bacteria 1834
64 Ga0105239_10513872 3300010375 Bacteria 1362
65 Ga0105239_10628024 3300010375 Bacteria 1226
66 Ga0157369_10029792 3300013105 Bacteria 6028
67 Ga0157369_10083193 3300013105 Bacteria 3423
68 Ga0157369_10235051 3300013105 Bacteria 1915
69 Ga0157374_10032627 3300013296 Bacteria 4744
70 Ga0157374_10845610 3300013296 Bacteria 932
71 Ga0157372_10002509 3300013307 Bacteria 19908
72 Ga0157372_10039498 3300013307 Bacteria 5209
73 Ga0157372_10051141 3300013307 Bacteria 4597
74 Ga0163163_10026831 3300014325 Bacteria 5510
75 Ga0157376_10039987 3300014969 Bacteria 3830
76 Ga0213872_10025942 3300021361 Unclassified 2692
77 Ga0207699_10794240 3300025906 Bacteria 696
78 Ga0207707_10047394 3300025912 Bacteria 3742
79 Ga0207707_10573197 3300025912 Bacteria 957
80 Ga0207695_10032490 3300025913 Bacteria 5710
81 Ga0207695_10167661 3300025913 Bacteria 2123
82 Ga0207693_10025230 3300025915 Bacteria 4713
83 Ga0207663_10002693 3300025916 Bacteria 8569
84 Ga0207663_10010826 3300025916 Bacteria 4871
85 Ga0207660_10120592 3300025917 Bacteria 1986
86 Ga0207687_10004757 3300025927 Bacteria 9033
87 Ga0207700_10068974 3300025928 Bacteria 2712
88 Ga0207700_10183352 3300025928 Bacteria 1754
89 Ga0207664_10000116 3300025929 Bacteria 70438
90 Ga0207664_10104964 3300025929 Bacteria 2341
91 Ga0207664_10465823 3300025929 Bacteria 1129
92 Ga0207664_10783105 3300025929 Bacteria 858
93 Ga0207709_11313798 3300025935 Unclassified 598
94 Ga0207665_10709169 3300025939 Bacteria 791
95 Ga0207689_10461202 3300025942 Unclassified 1062
96 Ga0207661_10050355 3300025944 Bacteria 3318
97 Ga0207661_10567141 3300025944 Bacteria 1041
98 Ga0207712_10144167 3300025961 Bacteria 1831
99 Ga0207712_10661772 3300025961 Bacteria 908
100 Ga0207677_10885076 3300026023 Bacteria 804
101 Ga0207702_10811790 3300026078 Unclassified 925
102 Ga0207683_10538849 3300026121 Bacteria 1079
103 Ga0209813_10329907 3300027866 Unclassified 599
104 Ga0207428_10004150 3300027907 Bacteria 13886
105 Ga0268266_10012782 3300028379 Bacteria 7254
106 Ga0268266_10219544 3300028379 Bacteria 1747
107 Ga0265316_10297202 3300031344 Unclassified 1177
108 Ga0373923_0013951 3300035111 Bacteria 3007
109 Ga0373936_0001576 3300035113 Bacteria 8322
110 Ga0373953_0092536 3300035117 Bacteria 1266
111 Ga0373954_0003880 3300035118 Bacteria 6397
112 Ga0373956_0003507 3300035119 Bacteria 6313
113 Ga0373943_0007808 3300035170 Bacteria 4804
114 Ga0373955_0003704 3300035172 Bacteria 6729
115 Ga0373955_0108525 3300035172 Bacteria 1602
116 Ga0373924_0057238 3300035410 Bacteria 1625
117 Ga0373931_0111613 3300035691 Unclassified 1552
118 Ga0373935_0000134 3300035692 Bacteria 33892
119 Ga0373927_0000031 3300035695 Bacteria 105518
120 Ga0373933_0011220 3300035724 Bacteria 4931
121 Ga0373933_0496847 3300035724 Bacteria 799
122 Ga0373933_0672962 3300035724 Bacteria 680
123 Ga0373947_0000437 3300035725 Bacteria 23616
124 Ga0373937_0013711 3300036401 Bacteria 7141
125 Ga0373925_0001129 3300037068 Bacteria 23662
126 Ga0373925_0781234 3300037068 Unclassified 787
127 Ga0436364_1026932 3300037853 Unclassified 659
128 Ga0436360_1160091 3300039438 Bacteria 1023
129 Ga0436361_0653628 3300039447 Unclassified 3282
130 Ga0436363_1488836 3300039450 Unclassified 863
131 Ga0436362_0862262 3300039453 Bacteria 1040
132 Ga0466957_0599345 3300044842 Unclassified 771
133 Ga0495629_0327515 3300046459 Unclassified 1047
134 Ga0495651_0309160 3300046462 Bacteria 1058
135 Ga0495653_0049698 3300046463 Unclassified 3229
136 Ga0495580_0226148 3300046472 Bacteria 1285
137 Ga0495664_0029252 3300046477 Bacteria 3221
138 Ga0495652_0037022 3300046529 Bacteria 4237
139 Ga0495586_0502105 3300046535 Bacteria 700
140 Ga0495587_0052244 3300046536 Bacteria 2412
141 Ga0495667_0019981 3300046559 Bacteria 4517
142 Ga0495657_0126089 3300046675 Bacteria 1608
143 Ga0495623_0130266 3300046679 Bacteria 1507
144 Ga0495674_0020280 3300047319 Bacteria 6156
145 Ga0495674_0991742 3300047319 Bacteria 644
146 Ga0495680_0054297 3300047322 Bacteria 3112
147 Ga0495675_0003324 3300047444 Bacteria 9675
148 Ga0495684_0003000 3300047471 Bacteria 13277
149 Ga0496100_0736003 3300048903 Bacteria 771
150 Ga0496104_0193315 3300048907 Bacteria 1947
151 Ga0496109_0000073 3300048912 Bacteria 107495
152 Ga0496112_0288276 3300048915 Bacteria 1588
153 nmdc:mga03683_21953_c1 3300050489 Unclassified 2468
154 nmdc:mga00v17_452123_c1 3300050491 Bacteria 834
155 nmdc:mga0k408_238268_c1 3300050493 Bacteria 1086
156 nmdc:mga04h51_315073_c1 3300050495 Unclassified 640
157 nmdc:mga0qj67_326706_c1 3300050509 Unclassified 1241
158 nmdc:mga06r32_871860_c1 3300050510 Unclassified 858
159 nmdc:mga08y16_39286_c1 3300050511 Unclassified 4966
160 nmdc:mga0n895_62809_c1 3300050512 Bacteria 3672
161 nmdc:mga0rr50_250039_c1 3300050513 Bacteria 1472
162 nmdc:mga08x19_278767_c1 3300050514 Bacteria 1158

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039453 Ga0436362_0862262 Ga0436362_0862262_17_487 156
2 3300025935 Ga0207709_11313798 Ga0207709_113137981 161
3 3300027907 Ga0207428_10004150 Ga0207428_100041504 161
4 3300050511 nmdc:mga08y16_39286_c1 nmdc:mga08y16_39286_c1_2821_3354 161
5 3300005547 Ga0070693_100027112 Ga0070693_1000271125 162
6 3300005548 Ga0070665_100003673 Ga0070665_1000036736 162
7 3300005614 Ga0068856_100366055 Ga0068856_1003660552 162
8 3300005617 Ga0068859_100311765 Ga0068859_1003117652 162
9 3300006931 Ga0097620_100311742 Ga0097620_1003117422 162
10 3300009101 Ga0105247_10066255 Ga0105247_100662551 162
11 3300009174 Ga0105241_10641862 Ga0105241_106418622 162
12 3300009553 Ga0105249_10043258 Ga0105249_100432582 162
13 3300010375 Ga0105239_10628024 Ga0105239_106280242 162
14 3300013296 Ga0157374_10845610 Ga0157374_108456101 162
15 3300025906 Ga0207699_10794240 Ga0207699_107942401 162
16 3300025961 Ga0207712_10144167 Ga0207712_101441671 162
17 3300028379 Ga0268266_10012782 Ga0268266_100127825 162
18 3300035691 Ga0373931_0111613 Ga0373931_0111613_228_749 162
19 3300048907 Ga0496104_0193315 Ga0496104_0193315_177_677 162
20 3300005435 Ga0070714_100451668 Ga0070714_1004516682 163
21 3300005614 Ga0068856_100803704 Ga0068856_1008037042 163
22 3300006173 Ga0070716_100753248 Ga0070716_1007532482 163
23 3300009093 Ga0105240_10012391 Ga0105240_100123913 163
24 3300013105 Ga0157369_10029792 Ga0157369_100297924 163
25 3300013105 Ga0157369_10235051 Ga0157369_102350512 163
26 3300013307 Ga0157372_10002509 Ga0157372_100025095 163
27 3300013307 Ga0157372_10039498 Ga0157372_100394983 163
28 3300013307 Ga0157372_10051141 Ga0157372_100511412 163
29 3300025913 Ga0207695_10032490 Ga0207695_100324904 163
30 3300025929 Ga0207664_10104964 Ga0207664_101049643 163
31 3300025939 Ga0207665_10709169 Ga0207665_107091692 163
32 3300025942 Ga0207689_10461202 Ga0207689_104612022 163
33 3300026078 Ga0207702_10811790 Ga0207702_108117902 163
34 3300005329 Ga0070683_100104719 Ga0070683_1001047193 164
35 3300005336 Ga0070680_100332726 Ga0070680_1003327262 164
36 3300005435 Ga0070714_100000092 Ga0070714_10000009232 164
37 3300005436 Ga0070713_100070408 Ga0070713_1000704084 164
38 3300005439 Ga0070711_100015117 Ga0070711_1000151173 164
39 3300005439 Ga0070711_100017789 Ga0070711_1000177894 164
40 3300005458 Ga0070681_10067927 Ga0070681_100679272 164
41 3300005547 Ga0070693_100192415 Ga0070693_1001924152 164
42 3300006175 Ga0070712_100425772 Ga0070712_1004257722 164
43 3300006852 Ga0075433_10247499 Ga0075433_102474993 164
44 3300006871 Ga0075434_100065568 Ga0075434_1000655684 164
45 3300006871 Ga0075434_101187569 Ga0075434_1011875692 164
46 3300025912 Ga0207707_10047394 Ga0207707_100473944 164
47 3300025915 Ga0207693_10025230 Ga0207693_100252306 164
48 3300025916 Ga0207663_10002693 Ga0207663_100026938 164
49 3300025916 Ga0207663_10010826 Ga0207663_100108264 164
50 3300025917 Ga0207660_10120592 Ga0207660_101205922 164
51 3300025928 Ga0207700_10183352 Ga0207700_101833522 164
52 3300025929 Ga0207664_10000116 Ga0207664_1000011624 164
53 3300025929 Ga0207664_10783105 Ga0207664_107831051 164
54 3300025944 Ga0207661_10050355 Ga0207661_100503553 164
55 3300035111 Ga0373923_0013951 Ga0373923_0013951_1710_2225 164
56 3300035113 Ga0373936_0001576 Ga0373936_0001576_5232_5747 164
57 3300035117 Ga0373953_0092536 Ga0373953_0092536_683_1198 164
58 3300035118 Ga0373954_0003880 Ga0373954_0003880_1563_2078 164
59 3300035119 Ga0373956_0003507 Ga0373956_0003507_3460_3975 164
60 3300035170 Ga0373943_0007808 Ga0373943_0007808_3281_3796 164
61 3300035172 Ga0373955_0003704 Ga0373955_0003704_4313_4828 164
62 3300035172 Ga0373955_0108525 Ga0373955_0108525_982_1497 164
63 3300035410 Ga0373924_0057238 Ga0373924_0057238_707_1222 164
64 3300035692 Ga0373935_0000134 Ga0373935_0000134_22180_22695 164
65 3300035695 Ga0373927_0000031 Ga0373927_0000031_79967_80482 164
66 3300035724 Ga0373933_0011220 Ga0373933_0011220_994_1509 164
67 3300035724 Ga0373933_0496847 Ga0373933_0496847_216_722 164
68 3300035725 Ga0373947_0000437 Ga0373947_0000437_12827_13342 164
69 3300036401 Ga0373937_0013711 Ga0373937_0013711_4849_5364 164
70 3300037068 Ga0373925_0001129 Ga0373925_0001129_16926_17441 164
71 3300037068 Ga0373925_0781234 Ga0373925_0781234_190_705 164
72 3300039450 Ga0436363_1488836 Ga0436363_1488836_325_819 164
73 3300044842 Ga0466957_0599345 Ga0466957_0599345_142_639 164
74 3300046463 Ga0495653_0049698 Ga0495653_0049698_771_1286 164
75 3300046477 Ga0495664_0029252 Ga0495664_0029252_1241_1756 164
76 3300046535 Ga0495586_0502105 Ga0495586_0502105_42_557 164
77 3300047319 Ga0495674_0020280 Ga0495674_0020280_1362_1877 164
78 3300050512 nmdc:mga0n895_62809_c1 nmdc:mga0n895_62809_c1_1969_2481 164
79 3300050514 nmdc:mga08x19_278767_c1 nmdc:mga08x19_278767_c1_509_1015 164
80 3300005445 Ga0070708_101017599 Ga0070708_1010175991 165
81 3300005548 Ga0070665_100048420 Ga0070665_1000484206 165
82 3300005718 Ga0068866_10275959 Ga0068866_102759592 165
83 3300006042 Ga0075368_10416056 Ga0075368_104160561 165
84 3300006175 Ga0070712_100085347 Ga0070712_1000853472 165
85 3300006237 Ga0097621_100254050 Ga0097621_1002540502 165
86 3300014969 Ga0157376_10039987 Ga0157376_100399874 165
87 3300026121 Ga0207683_10538849 Ga0207683_105388492 165
88 3300027866 Ga0209813_10329907 Ga0209813_103299071 165
89 3300028379 Ga0268266_10219544 Ga0268266_102195441 165
90 3300031344 Ga0265316_10297202 Ga0265316_102972022 165
91 3300035724 Ga0373933_0672962 Ga0373933_0672962_19_516 165
92 3300037853 Ga0436364_1026932 Ga0436364_1026932_102_611 165
93 3300046459 Ga0495629_0327515 Ga0495629_0327515_169_678 165
94 3300048903 Ga0496100_0736003 Ga0496100_0736003_26_529 165
95 3300048912 Ga0496109_0000073 Ga0496109_0000073_25192_25689 165
96 3300050495 nmdc:mga04h51_315073_c1 nmdc:mga04h51_315073_c1_63_563 165
97 3300003320 rootH2_10171567 rootH2_101715672 166
98 3300005338 Ga0068868_100148229 Ga0068868_1001482291 166
99 3300005436 Ga0070713_100396907 Ga0070713_1003969072 166
100 3300005436 Ga0070713_100901194 Ga0070713_1009011941 166
101 3300005445 Ga0070708_100124145 Ga0070708_1001241453 166
102 3300005468 Ga0070707_100054929 Ga0070707_1000549295 166
103 3300005535 Ga0070684_100020026 Ga0070684_1000200264 166
104 3300005536 Ga0070697_101122200 Ga0070697_1011222001 166
105 3300005539 Ga0068853_100027642 Ga0068853_1000276424 166
106 3300005539 Ga0068853_100049597 Ga0068853_1000495972 166
107 3300005578 Ga0068854_100066986 Ga0068854_1000669864 166
108 3300005578 Ga0068854_100255795 Ga0068854_1002557952 166
109 3300005834 Ga0068851_10252734 Ga0068851_102527342 166
110 3300005834 Ga0068851_10699326 Ga0068851_106993261 166
111 3300006028 Ga0070717_10855644 Ga0070717_108556441 166
112 3300006038 Ga0075365_10037926 Ga0075365_100379263 166
113 3300006173 Ga0070716_100204660 Ga0070716_1002046602 166
114 3300006195 Ga0075366_10041937 Ga0075366_100419372 166
115 3300006844 Ga0075428_100308964 Ga0075428_1003089643 166
116 3300006844 Ga0075428_100977675 Ga0075428_1009776752 166
117 3300006847 Ga0075431_100216485 Ga0075431_1002164852 166
118 3300006847 Ga0075431_100271443 Ga0075431_1002714433 166
119 3300007076 Ga0075435_100050364 Ga0075435_1000503644 166
120 3300009093 Ga0105240_10153065 Ga0105240_101530652 166
121 3300009093 Ga0105240_10223174 Ga0105240_102231742 166
122 3300009094 Ga0111539_10274650 Ga0111539_102746502 166
123 3300009098 Ga0105245_10001306 Ga0105245_1000130613 166
124 3300009545 Ga0105237_10800299 Ga0105237_108002991 166
125 3300009545 Ga0105237_11050018 Ga0105237_110500182 166
126 3300009551 Ga0105238_10037638 Ga0105238_100376384 166
127 3300009551 Ga0105238_10069535 Ga0105238_100695353 166
128 3300009553 Ga0105249_10948819 Ga0105249_109488192 166
129 3300010375 Ga0105239_10292628 Ga0105239_102926282 166
130 3300010375 Ga0105239_10513872 Ga0105239_105138722 166
131 3300013105 Ga0157369_10083193 Ga0157369_100831934 166
132 3300013296 Ga0157374_10032627 Ga0157374_100326272 166
133 3300014325 Ga0163163_10026831 Ga0163163_100268314 166
134 3300021361 Ga0213872_10025942 Ga0213872_100259422 166
135 3300025912 Ga0207707_10573197 Ga0207707_105731972 166
136 3300025913 Ga0207695_10167661 Ga0207695_101676613 166
137 3300025927 Ga0207687_10004757 Ga0207687_100047578 166
138 3300025928 Ga0207700_10068974 Ga0207700_100689742 166
139 3300025929 Ga0207664_10465823 Ga0207664_104658232 166
140 3300025944 Ga0207661_10567141 Ga0207661_105671412 166
141 3300025961 Ga0207712_10661772 Ga0207712_106617722 166
142 3300026023 Ga0207677_10885076 Ga0207677_108850762 166
143 3300039438 Ga0436360_1160091 Ga0436360_1160091_358_864 166
144 3300039447 Ga0436361_0653628 Ga0436361_0653628_2357_2863 166
145 3300046462 Ga0495651_0309160 Ga0495651_0309160_244_756 166
146 3300046472 Ga0495580_0226148 Ga0495580_0226148_35_559 166
147 3300046529 Ga0495652_0037022 Ga0495652_0037022_1334_1840 166
148 3300046536 Ga0495587_0052244 Ga0495587_0052244_339_845 166
149 3300046559 Ga0495667_0019981 Ga0495667_0019981_1757_2263 166
150 3300046675 Ga0495657_0126089 Ga0495657_0126089_351_857 166
151 3300046679 Ga0495623_0130266 Ga0495623_0130266_344_850 166
152 3300047319 Ga0495674_0991742 Ga0495674_0991742_105_611 166
153 3300047322 Ga0495680_0054297 Ga0495680_0054297_2048_2554 166
154 3300047444 Ga0495675_0003324 Ga0495675_0003324_7194_7700 166
155 3300047471 Ga0495684_0003000 Ga0495684_0003000_7041_7547 166
156 3300048915 Ga0496112_0288276 Ga0496112_0288276_365_877 166
157 3300050489 nmdc:mga03683_21953_c1 nmdc:mga03683_21953_c1_1076_1603 166
158 3300050491 nmdc:mga00v17_452123_c1 nmdc:mga00v17_452123_c1_108_632 166
159 3300050493 nmdc:mga0k408_238268_c1 nmdc:mga0k408_238268_c1_33_545 166
160 3300050509 nmdc:mga0qj67_326706_c1 nmdc:mga0qj67_326706_c1_317_847 166
161 3300050510 nmdc:mga06r32_871860_c1 nmdc:mga06r32_871860_c1_261_791 166
162 3300050513 nmdc:mga0rr50_250039_c1 nmdc:mga0rr50_250039_c1_491_997 166

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12867

DinB_2

DinB superfamily

35

156

0.82

PF05163

DinB

DinB family

22

173

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
3di5-assembly1.cif.gz_A crystal structure of a dinb-like protein (bce_4655) from bacillus cereus atcc 10987 at 2.01 a resolution 0.812 11 145
3di5-assembly1.cif.gz_A crystal structure of a dinb-like protein (bce_4655) from bacillus cereus atcc 10987 at 2.01 a resolution 0.7361 11 145
2p1a-assembly1.cif.gz_A crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution 0.7248 11 142
2qnl-assembly1.cif.gz_A-2 crystal structure of a putative dna damage-inducible protein (chu_0679) from cytophaga hutchinsonii atcc 33406 at 1.50 a resolution 0.7069 4 140
2p1a-assembly1.cif.gz_B crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution 0.7017 10 143
ID Description Score Start End Superfamily
af_P9WM91_7_150_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7713 14 141 1.20.120.450
3di5A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7514 11 143 1.20.120.450
af_O53773_242_434_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7048 13 142 1.20.120.450
af_Q2FUS3_1_147_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6994 13 137 1.20.120.450
3di5A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6977 11 143 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A2V9XND5-F1-model_v4 Damage-inducible protein DinB 0.9117 25 165
AF-A0A399ETD5-F1-model_v4 DinB family protein 0.9006 6 166
AF-A0A7Y5USW9-F1-model_v4 DinB family protein 0.8959 9 163
AF-A0A537JK22-F1-model_v4 Damage-inducible protein DinB 0.8921 10 160
AF-A0A523PVT9-F1-model_v4 DinB-like domain-containing protein 0.8913 13 166

Feature Viewer

pLDDT pTM Quality
92.6 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map