F238288

General Info

Members Datasets Scaffolds Average Seq Length
162 98 162 383

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10001636|rootH1_1000163622
Length 427
Sequence MPAPPFDADSKKEIYKRIRILGFEKLSCCKIDLMKLLLVALAFVILIGSEILKVYYIMPFPGSQRDETITLAYFLNQNILYFRVAGWLLLLYSLFSTWGTMSVSIKVIIGIFFSVYLFVLILFNFYFLADKMFYQPSHKIFASASDNKVDARKLVVGVSINGESKAYPIEIIGYHHQVRDTVGGKGIMVTYCTVCRTGRVYDPTVDGRNESFRLVGMDHFNAMFEDNDTKSWWRQADGKAIVGKEKGKQLMELPSEQMTLLAWLRLHPDSKVMQPDSAYQLGYEGLQGFDNGTIGSNLEHRDSLSWKDKSWIVGIQIGKKARAYDWNELFRHRVINDTLDGTPILIALQNDSATFHVWERDTLTFSLAEAANYLIDSNTVSTWNMDGECVSGSQKGRKLPSVQSYQEFWHSWKTFHPHTTRYQKSND

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
39 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
47 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
48 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
50 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
52 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
72 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
73 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
74 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
75 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
76 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
77 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
78 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
79 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
80 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
81 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
82 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
83 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
84 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
85 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
86 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
87 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
89 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
90 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
91 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
92 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
93 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
94 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
95 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
96 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
97 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
98 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.96
Nodule 0
Rhizoplane 0
Rhizosphere 70.99
Stem 0
Stem Tuber 0
Unclassified 16.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10003879 3300001989 Bacteria 5715
2 JGI25153J46596_10042434 3300003215 Bacteria 1388
3 rootH1_10003422 3300003316 Bacteria 22736
4 rootH2_10002530 3300003320 Bacteria 24978
5 rootH2_10026715 3300003320 Bacteria 19405
6 rootL2_10007725 3300003322 Bacteria 4799
7 rootL2_10009056 3300003322 Bacteria 7045
8 rootL2_10045290 3300003322 Bacteria 4749
9 rootL2_10075792 3300003322 Bacteria 5855
10 rootL2_10120530 3300003322 Bacteria 3041
11 rootL2_10149015 3300003322 Bacteria 4137
12 rootL2_10181182 3300003322 Unclassified 2193
13 rootH1_10001636 3300003323 Bacteria 76904
14 rootH1_10012305 3300003323 Bacteria 2426
15 rootH1_10024772 3300003323 Bacteria 5013
16 rootH1_10024796 3300003323 Bacteria 6122
17 rootH1_10095601 3300003323 Bacteria 3905
18 rootH1_10255422 3300003323 Bacteria 4780
19 JGI25160J50197_1001458 3300003354 Bacteria 11794
20 JGI25160J50197_1008778 3300003354 Bacteria 3818
21 Ga0055526_1032268 3300003771 Bacteria 1482
22 Ga0055528_1000698 3300003790 Bacteria 23873
23 Ga0055528_1001196 3300003790 Bacteria 16730
24 Ga0055531_10005052 3300003794 Bacteria 7820
25 Ga0065165_1000012 3300005262 Bacteria 303241
26 Ga0065165_1000505 3300005262 Bacteria 60144
27 Ga0070683_100038010 3300005329 Bacteria 4410
28 Ga0070666_10000208 3300005335 Bacteria 40242
29 Ga0070666_10096467 3300005335 Bacteria 2035
30 Ga0070680_100120174 3300005336 Bacteria 2193
31 Ga0070682_100000152 3300005337 Bacteria 54283
32 Ga0070667_100003194 3300005367 Bacteria 14042
33 Ga0070685_10119005 3300005466 Bacteria 1638
34 Ga0068853_100313364 3300005539 Bacteria 1453
35 Ga0070672_100083526 3300005543 Unclassified 2563
36 Ga0070665_100000008 3300005548 Bacteria 606341
37 Ga0068856_100054474 3300005614 Unclassified 3945
38 Ga0068852_100005244 3300005616 Bacteria 9245
39 Ga0068852_100088240 3300005616 Bacteria 2769
40 Ga0068859_100000006 3300005617 Bacteria 421509
41 Ga0068859_100009998 3300005617 Bacteria 9568
42 Ga0068859_100033856 3300005617 Bacteria 5130
43 Ga0068864_100002292 3300005618 Bacteria 15821
44 Ga0068863_100009756 3300005841 Bacteria 9363
45 Ga0068858_100000396 3300005842 Bacteria 45694
46 Ga0068860_100000029 3300005843 Bacteria 259192
47 Ga0068860_100000502 3300005843 Bacteria 48523
48 Ga0068860_100001991 3300005843 Bacteria 21550
49 Ga0068860_100003067 3300005843 Bacteria 17262
50 Ga0068860_100032682 3300005843 Bacteria 4999
51 Ga0097621_100008827 3300006237 Bacteria 7286
52 Ga0097621_100044186 3300006237 Bacteria 3594
53 Ga0068871_100004064 3300006358 Bacteria 10122
54 Ga0097620_100000006 3300006931 Bacteria 421509
55 Ga0097620_100009998 3300006931 Bacteria 9568
56 Ga0097620_100033856 3300006931 Bacteria 5130
57 Ga0105240_10002159 3300009093 Bacteria 32133
58 Ga0105240_10311940 3300009093 Bacteria 1796
59 Ga0111539_10315868 3300009094 Unclassified 1818
60 Ga0105247_10003209 3300009101 Bacteria 10774
61 Ga0105241_10004686 3300009174 Bacteria 10099
62 Ga0105237_10000171 3300009545 Bacteria 90778
63 Ga0105237_10000474 3300009545 Bacteria 57006
64 Ga0105237_10002941 3300009545 Bacteria 20624
65 Ga0105237_10004722 3300009545 Bacteria 15671
66 Ga0105239_10004967 3300010375 Bacteria 15708
67 Ga0105239_10015504 3300010375 Bacteria 8440
68 Ga0105239_10024847 3300010375 Bacteria 6599
69 Ga0105239_10056134 3300010375 Bacteria 4319
70 Ga0105246_10009305 3300011119 Bacteria 6050
71 Ga0157373_10184382 3300013100 Bacteria 1470
72 Ga0157371_10051253 3300013102 Bacteria 2933
73 Ga0157374_10061471 3300013296 Bacteria 3518
74 Ga0157374_10162988 3300013296 Bacteria 2172
75 Ga0157374_10334801 3300013296 Bacteria 1502
76 Ga0157378_10001999 3300013297 Bacteria 18236
77 Ga0157378_10007921 3300013297 Bacteria 9270
78 Ga0157378_10008669 3300013297 Bacteria 8850
79 Ga0157378_10101014 3300013297 Unclassified 2634
80 Ga0157378_10127373 3300013297 Bacteria 2353
81 Ga0157378_10204243 3300013297 Unclassified 1870
82 Ga0163162_10000038 3300013306 Bacteria 138065
83 Ga0163162_10000519 3300013306 Bacteria 35771
84 Ga0163162_10022858 3300013306 Bacteria 6165
85 Ga0157372_10138094 3300013307 Bacteria 2808
86 Ga0157372_10228868 3300013307 Bacteria 2155
87 Ga0157372_10260594 3300013307 Bacteria 2013
88 Ga0157372_10285331 3300013307 Bacteria 1920
89 Ga0157380_10069074 3300014326 Bacteria 2850
90 Ga0157376_10004296 3300014969 Bacteria 9899
91 Ga0157376_10065274 3300014969 Bacteria 3073
92 Ga0157376_10094551 3300014969 Bacteria 2597
93 Ga0213876_10008685 3300021384 Bacteria 5496
94 Ga0209673_1000016 3300025273 Bacteria 506202
95 Ga0209673_1000111 3300025273 Bacteria 180094
96 Ga0209564_1009974 3300025295 Bacteria 4438
97 Ga0209564_1014573 3300025295 Bacteria 3260
98 Ga0209758_1003887 3300025297 Bacteria 13070
99 Ga0209758_1009602 3300025297 Bacteria 5974
100 Ga0209050_1000444 3300025298 Bacteria 74945
101 Ga0207426_1000241 3300025302 Bacteria 122857
102 Ga0207426_1000606 3300025302 Bacteria 46465
103 Ga0209257_1000005 3300025304 Bacteria 1592528
104 Ga0209257_1002226 3300025304 Bacteria 19949
105 Ga0207680_10000072 3300025903 Bacteria 44683
106 Ga0207680_10076714 3300025903 Bacteria 2088
107 Ga0207654_10001964 3300025911 Bacteria 10651
108 Ga0207695_10386689 3300025913 Bacteria 1284
109 Ga0207671_10003558 3300025914 Bacteria 15439
110 Ga0207671_10010219 3300025914 Bacteria 7768
111 Ga0207671_10192208 3300025914 Bacteria 1592
112 Ga0207644_10191801 3300025931 Unclassified 1607
113 Ga0207706_10367466 3300025933 Bacteria 1249
114 Ga0207691_10130309 3300025940 Unclassified 2222
115 Ga0207689_10000383 3300025942 Bacteria 41569
116 Ga0207651_10277564 3300025960 Bacteria 1383
117 Ga0207640_10263710 3300025981 Bacteria 1344
118 Ga0207658_10008471 3300025986 Bacteria 6996
119 Ga0207658_10067940 3300025986 Bacteria 2687
120 Ga0207677_10087993 3300026023 Bacteria 2251
121 Ga0207703_10005846 3300026035 Bacteria 9852
122 Ga0207702_10051934 3300026078 Unclassified 3467
123 Ga0207641_10000280 3300026088 Bacteria 64281
124 Ga0207698_10070869 3300026142 Bacteria 2763
125 Ga0268266_10000016 3300028379 Bacteria 629101
126 Ga0268264_10000072 3300028381 Bacteria 260791
127 Ga0268264_10002679 3300028381 Bacteria 15543
128 Ga0268264_10004703 3300028381 Bacteria 11599
129 Ga0268264_10011245 3300028381 Bacteria 7396
130 Ga0268264_10013829 3300028381 Bacteria 6639
131 Ga0307517_10090716 3300028786 Bacteria 2504
132 Ga0307515_10000021 3300028794 Bacteria 406008
133 Ga0307515_10000394 3300028794 Bacteria 105754
134 Ga0307515_10244088 3300028794 Bacteria 1561
135 Ga0307511_10000650 3300030521 Bacteria 37078
136 Ga0307509_10112516 3300031507 Unclassified 2722
137 Ga0307516_10007608 3300031730 Bacteria 12416
138 Ga0307414_10295253 3300032004 Bacteria 1368
139 Ga0373937_0494490 3300036401 Unclassified 1162
140 Ga0436365_0738408 3300039437 Bacteria 10003
141 Ga0436365_0920295 3300039437 Bacteria 45426
142 Ga0451577_0040162 3300042876 Unclassified 4202
143 Ga0451576_0022420 3300045051 Bacteria 6847
144 Ga0451576_0219594 3300045051 Bacteria 1985
145 Ga0495638_0057437 3300046460 Bacteria 2413
146 Ga0495580_0249752 3300046472 Bacteria 1215
147 Ga0495643_0037008 3300046522 Unclassified 2679
148 Ga0495611_0000084 3300046648 Bacteria 66870
149 Ga0495687_000004 3300047443 Bacteria 779298
150 Ga0495686_0002430 3300047472 Bacteria 17597
151 Ga0501034_0125675 3300049571 Bacteria 2550
152 Ga0501070_0008512 3300049586 Bacteria 8671
153 Ga0501072_0181756 3300049588 Bacteria 1678
154 Ga0501073_0012114 3300049589 Bacteria 6297
155 Ga0501074_0153820 3300049590 Bacteria 1644
156 Ga0501236_000470 3300049670 Bacteria 4568
157 Ga0501079_0175186 3300049741 Bacteria 1673
158 Ga0501083_0013031 3300049744 Bacteria 5808
159 Ga0501264_000078 3300049761 Bacteria 14014
160 Ga0500583_0000327 3300053092 Bacteria 15991
161 Ga0501084_0040148 3300054114 Bacteria 3914
162 Ga0501082_0014191 3300060353 Bacteria 6857

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009545 Ga0105237_10000474 Ga0105237_1000047447 316
2 3300025933 Ga0207706_10367466 Ga0207706_103674661 318
3 3300003320 rootH2_10002530 rootH2_100025305 337
4 3300025914 Ga0207671_10010219 Ga0207671_100102194 342
5 3300031507 Ga0307509_10112516 Ga0307509_101125162 343
6 3300036401 Ga0373937_0494490 Ga0373937_0494490_40_1152 347
7 3300003322 rootL2_10007725 rootL2_100077251 350
8 3300009093 Ga0105240_10002159 Ga0105240_1000215922 350
9 3300009545 Ga0105237_10000171 Ga0105237_1000017159 350
10 3300025903 Ga0207680_10076714 Ga0207680_100767142 350
11 3300046472 Ga0495580_0249752 Ga0495580_0249752_67_1200 351
12 3300005543 Ga0070672_100083526 Ga0070672_1000835264 354
13 3300005617 Ga0068859_100000006 Ga0068859_100000006206 354
14 3300005618 Ga0068864_100002292 Ga0068864_1000022927 354
15 3300005842 Ga0068858_100000396 Ga0068858_10000039646 354
16 3300005843 Ga0068860_100003067 Ga0068860_10000306713 354
17 3300006931 Ga0097620_100000006 Ga0097620_100000006206 354
18 3300009101 Ga0105247_10003209 Ga0105247_1000320911 354
19 3300009174 Ga0105241_10004686 Ga0105241_1000468615 354
20 3300010375 Ga0105239_10056134 Ga0105239_100561342 354
21 3300011119 Ga0105246_10009305 Ga0105246_100093053 354
22 3300013296 Ga0157374_10334801 Ga0157374_103348011 354
23 3300013297 Ga0157378_10204243 Ga0157378_102042432 354
24 3300013306 Ga0163162_10000519 Ga0163162_100005195 354
25 3300014969 Ga0157376_10065274 Ga0157376_100652742 354
26 3300025911 Ga0207654_10001964 Ga0207654_100019644 354
27 3300025940 Ga0207691_10130309 Ga0207691_101303092 354
28 3300025942 Ga0207689_10000383 Ga0207689_1000038328 354
29 3300026035 Ga0207703_10005846 Ga0207703_100058465 354
30 3300026088 Ga0207641_10000280 Ga0207641_1000028055 354
31 3300028381 Ga0268264_10004703 Ga0268264_100047035 354
32 3300046648 Ga0495611_0000084 Ga0495611_0000084_28293_29474 354
33 3300049670 Ga0501236_000470 Ga0501236_000470_3318_4505 359
34 3300049761 Ga0501264_000078 Ga0501264_000078_11861_13048 359
35 3300009094 Ga0111539_10315868 Ga0111539_103158681 360
36 3300025931 Ga0207644_10191801 Ga0207644_101918012 362
37 3300026023 Ga0207677_10087993 Ga0207677_100879932 366
38 3300005335 Ga0070666_10000208 Ga0070666_1000020822 367
39 3300005616 Ga0068852_100005244 Ga0068852_1000052442 367
40 3300009545 Ga0105237_10004722 Ga0105237_1000472213 367
41 3300025903 Ga0207680_10000072 Ga0207680_1000007235 367
42 3300025914 Ga0207671_10003558 Ga0207671_100035589 367
43 3300026142 Ga0207698_10070869 Ga0207698_100708692 367
44 3300049588 Ga0501072_0181756 Ga0501072_0181756_503_1615 368
45 3300049590 Ga0501074_0153820 Ga0501074_0153820_56_1168 368
46 3300005841 Ga0068863_100009756 Ga0068863_1000097564 369
47 3300025960 Ga0207651_10277564 Ga0207651_102775641 369
48 3300005367 Ga0070667_100003194 Ga0070667_10000319412 370
49 3300005617 Ga0068859_100033856 Ga0068859_1000338566 370
50 3300005843 Ga0068860_100000502 Ga0068860_10000050234 370
51 3300006931 Ga0097620_100033856 Ga0097620_1000338566 370
52 3300013297 Ga0157378_10007921 Ga0157378_1000792110 370
53 3300025986 Ga0207658_10008471 Ga0207658_100084716 370
54 3300028381 Ga0268264_10013829 Ga0268264_100138292 370
55 3300009093 Ga0105240_10311940 Ga0105240_103119402 372
56 3300013307 Ga0157372_10228868 Ga0157372_102288682 372
57 3300025913 Ga0207695_10386689 Ga0207695_103866891 372
58 3300028794 Ga0307515_10244088 Ga0307515_102440882 373
59 3300003322 rootL2_10181182 rootL2_101811822 374
60 3300005335 Ga0070666_10096467 Ga0070666_100964672 374
61 3300010375 Ga0105239_10004967 Ga0105239_100049676 374
62 3300025986 Ga0207658_10067940 Ga0207658_100679402 374
63 3300028794 Ga0307515_10000021 Ga0307515_10000021111 374
64 3300045051 Ga0451576_0022420 Ga0451576_0022420_5009_6202 375
65 3300003322 rootL2_10009056 rootL2_100090567 376
66 3300013100 Ga0157373_10184382 Ga0157373_101843821 376
67 3300013307 Ga0157372_10138094 Ga0157372_101380941 376
68 3300003322 rootL2_10149015 rootL2_101490153 378
69 3300003320 rootH2_10026715 rootH2_1002671512 379
70 3300013297 Ga0157378_10101014 Ga0157378_101010142 379
71 3300005262 Ga0065165_1000505 Ga0065165_100050536 380
72 3300010375 Ga0105239_10024847 Ga0105239_100248474 380
73 3300045051 Ga0451576_0219594 Ga0451576_0219594_527_1690 380
74 3300005466 Ga0070685_10119005 Ga0070685_101190052 381
75 3300009545 Ga0105237_10002941 Ga0105237_100029412 381
76 3300013307 Ga0157372_10285331 Ga0157372_102853312 381
77 3300025914 Ga0207671_10192208 Ga0207671_101922081 381
78 3300032004 Ga0307414_10295253 Ga0307414_102952531 381
79 3300047472 Ga0495686_0002430 Ga0495686_0002430_11986_13254 381
80 3300003354 JGI25160J50197_1008778 JGI25160J50197_10087785 382
81 3300005336 Ga0070680_100120174 Ga0070680_1001201742 382
82 3300025302 Ga0207426_1000241 Ga0207426_10002416 382
83 3300046522 Ga0495643_0037008 Ga0495643_0037008_979_2244 382
84 3300005548 Ga0070665_100000008 Ga0070665_100000008251 383
85 3300014326 Ga0157380_10069074 Ga0157380_100690743 383
86 3300028379 Ga0268266_10000016 Ga0268266_10000016249 383
87 3300013296 Ga0157374_10061471 Ga0157374_100614715 385
88 3300025981 Ga0207640_10263710 Ga0207640_102637101 385
89 3300003323 rootH1_10012305 rootH1_100123052 387
90 3300005616 Ga0068852_100088240 Ga0068852_1000882403 387
91 3300006237 Ga0097621_100044186 Ga0097621_1000441862 387
92 3300013296 Ga0157374_10162988 Ga0157374_101629881 387
93 3300003322 rootL2_10120530 rootL2_101205302 388
94 3300003794 Ga0055531_10005052 Ga0055531_100050525 388
95 3300005337 Ga0070682_100000152 Ga0070682_10000015221 388
96 3300025304 Ga0209257_1000005 Ga0209257_10000051324 388
97 3300003316 rootH1_10003422 rootH1_100034225 389
98 3300003322 rootL2_10045290 rootL2_100452904 389
99 3300003322 rootL2_10075792 rootL2_100757922 389
100 3300003323 rootH1_10001636 rootH1_1000163622 389
101 3300003323 rootH1_10024772 rootH1_100247722 389
102 3300003323 rootH1_10024796 rootH1_100247962 389
103 3300003323 rootH1_10095601 rootH1_100956014 389
104 3300003323 rootH1_10255422 rootH1_102554222 389
105 3300005614 Ga0068856_100054474 Ga0068856_1000544743 389
106 3300013307 Ga0157372_10260594 Ga0157372_102605943 389
107 3300026078 Ga0207702_10051934 Ga0207702_100519342 389
108 3300031730 Ga0307516_10007608 Ga0307516_100076082 389
109 3300021384 Ga0213876_10008685 Ga0213876_100086854 390
110 3300030521 Ga0307511_10000650 Ga0307511_100006505 390
111 3300039437 Ga0436365_0920295 Ga0436365_0920295_33244_34506 390
112 3300006237 Ga0097621_100008827 Ga0097621_1000088274 391
113 3300006358 Ga0068871_100004064 Ga0068871_1000040649 391
114 3300013297 Ga0157378_10001999 Ga0157378_1000199911 391
115 3300014969 Ga0157376_10004296 Ga0157376_1000429614 391
116 3300003215 JGI25153J46596_10042434 JGI25153J46596_100424341 392
117 3300005539 Ga0068853_100313364 Ga0068853_1003133641 392
118 3300005617 Ga0068859_100009998 Ga0068859_1000099986 392
119 3300005843 Ga0068860_100001991 Ga0068860_1000019918 392
120 3300006931 Ga0097620_100009998 Ga0097620_1000099986 392
121 3300013297 Ga0157378_10008669 Ga0157378_100086693 392
122 3300013297 Ga0157378_10127373 Ga0157378_101273732 392
123 3300025295 Ga0209564_1014573 Ga0209564_10145732 392
124 3300025297 Ga0209758_1009602 Ga0209758_10096025 392
125 3300028381 Ga0268264_10011245 Ga0268264_100112451 392
126 3300039437 Ga0436365_0738408 Ga0436365_0738408_8571_9755 392
127 3300049571 Ga0501034_0125675 Ga0501034_0125675_178_1362 392
128 3300049586 Ga0501070_0008512 Ga0501070_0008512_5134_6318 392
129 3300049589 Ga0501073_0012114 Ga0501073_0012114_4557_5741 392
130 3300049741 Ga0501079_0175186 Ga0501079_0175186_219_1403 392
131 3300049744 Ga0501083_0013031 Ga0501083_0013031_1813_2997 392
132 3300054114 Ga0501084_0040148 Ga0501084_0040148_1094_2278 392
133 3300060353 Ga0501082_0014191 Ga0501082_0014191_5660_6844 392
134 3300001989 JGI24739J22299_10003879 JGI24739J22299_100038793 393
135 3300003354 JGI25160J50197_1001458 JGI25160J50197_10014585 393
136 3300003771 Ga0055526_1032268 Ga0055526_10322682 393
137 3300003790 Ga0055528_1000698 Ga0055528_100069819 393
138 3300003790 Ga0055528_1001196 Ga0055528_10011964 393
139 3300005262 Ga0065165_1000012 Ga0065165_1000012175 393
140 3300005329 Ga0070683_100038010 Ga0070683_1000380104 393
141 3300005843 Ga0068860_100000029 Ga0068860_10000002989 393
142 3300005843 Ga0068860_100032682 Ga0068860_1000326823 393
143 3300010375 Ga0105239_10015504 Ga0105239_100155046 393
144 3300013102 Ga0157371_10051253 Ga0157371_100512532 393
145 3300013306 Ga0163162_10000038 Ga0163162_1000003866 393
146 3300013306 Ga0163162_10022858 Ga0163162_100228584 393
147 3300014969 Ga0157376_10094551 Ga0157376_100945512 393
148 3300025273 Ga0209673_1000016 Ga0209673_1000016395 393
149 3300025273 Ga0209673_1000111 Ga0209673_100011149 393
150 3300025295 Ga0209564_1009974 Ga0209564_10099744 393
151 3300025297 Ga0209758_1003887 Ga0209758_10038876 393
152 3300025298 Ga0209050_1000444 Ga0209050_100044458 393
153 3300025302 Ga0207426_1000606 Ga0207426_10006063 393
154 3300025304 Ga0209257_1002226 Ga0209257_10022261 393
155 3300028381 Ga0268264_10000072 Ga0268264_1000007290 393
156 3300028381 Ga0268264_10002679 Ga0268264_100026792 393
157 3300028786 Ga0307517_10090716 Ga0307517_100907162 393
158 3300028794 Ga0307515_10000394 Ga0307515_1000039457 393
159 3300042876 Ga0451577_0040162 Ga0451577_0040162_1772_2962 393
160 3300046460 Ga0495638_0057437 Ga0495638_0057437_586_1776 393
161 3300047443 Ga0495687_000004 Ga0495687_000004_361388_362593 393
162 3300053092 Ga0500583_0000327 Ga0500583_0000327_1489_2679 393

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11376

DUF3179

Protein of unknown function (DUF3179)

135

419

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cxm-assembly2.cif.gz_D crystal structure of the cyanobacterial plasma membrane rieske protein petc3 from synechocystis pcc 6803 0.7342 294 376
8hn2-assembly1.cif.gz_B selenomethionine-labelled soluble domain of rieske iron-sulfur protein from chlorobaculum tepidum 0.7274 299 377
4nbf-assembly1.cif.gz_C oxygenase with gln282 replaced by asn and ferredoxin complex of carbazole 1,9a-dioxygenase 0.6878 301 378
5vgc-assembly1.cif.gz_B crystal structure of the nleg5-1 effector (c200a) from escherichia coli o157:h7 str. sakai 0.6734 294 332
5bok-assembly1.cif.gz_A ferredoxin component of 3-nitrotoluene dioxygenase from diaphorobacter sp. strain ds2 0.6677 277 376
ID Description Score Start End Superfamily
5cxmD00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.7342 294 376 2.102.10.10
af_I1JZ61_209_331_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.7249 293 377 2.102.10.10
5bokA00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.6677 277 376 2.102.10.10
3gceA00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.6631 143 219 2.102.10.10
af_Q1L8U8_722_786_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.6586 171 201 2.30.30.140
ID Description Score Start End GO Terms
AF-A0A7Y4XL50-F1-model_v4 DUF3179 domain-containing protein 0.9924 1 393 GO:0016020
AF-A0A5J5IEH3-F1-model_v4 DUF3179 domain-containing protein 0.9916 1 389 GO:0016020
AF-A0A4Q3N2L6-F1-model_v4 DUF3179 domain-containing protein 0.9905 135 391
AF-A0A7Y4XL50-F1-model_v4 DUF3179 domain-containing protein 0.9898 1 393 GO:0016020
AF-A0A1S2VMK5-F1-model_v4 DUF3179 domain-containing protein 0.9876 1 392 GO:0016020

Feature Viewer

pLDDT pTM Quality
92.5 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map