F238065

General Info

Members Datasets Scaffolds Average Seq Length
161 144 322 359

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2547132111|2547405655
Length 385
Sequence PQTDPLNEGRRDAPVSGHTPVLGIRALNRATLARQLLLDRADLPVPDAVAHLGGMQAQEPQEPFVGLWSRLRAFRPPSLSDRLTDRRLVRTHLMRRTVHLVTADDVLAWRSRHDAMLRQKVLGTYRRELTGVDLAELAAAGREVMSDGEPRSMGELARAVAGRWPAPGPRALGEMLAAALIPMAQLPPRGLWRTRSGARYLPLSDWLGRDVDPPSPPGTDPVGRALVRRYLTAFGPAASADLRAWCGLAGLPAAVAAVREELVVFRDERGRELLDLPDAPRPDPGTPAPVRFLPAFDNAILGYHDRSRVIDDAHRGLSVAGARVVLVDGRVAATWNEDADTVTVAPLHPLAEADRAAVEEEGRALASFLSDGRSDRVRVGASPDA

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
11 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
14 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
15 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
16 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
17 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
21 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
22 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
23 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
24 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
25 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
39 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
40 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
41 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
42 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
43 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
44 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
45 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
46 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
47 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
48 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
49 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
50 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
51 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
52 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
53 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
54 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
55 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
56 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
57 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
58 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
59 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
60 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
61 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
62 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
63 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
64 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
65 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
66 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
67 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
68 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
69 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
70 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
71 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
72 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
73 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
74 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
75 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
84 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
86 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
87 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
88 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
89 2501939600 Micromonospora sp. L5 Isolate Unclassified
90 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
91 2643221548 Streptomyces sp. Root55 Isolate Unclassified
92 2643221578 Streptomyces sp. Root63 Isolate Unclassified
93 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
94 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
95 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
96 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
97 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
98 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
99 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
100 2808606448 Streptomyces sp. 193411 Isolate Unclassified
101 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
102 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
103 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
104 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
105 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
106 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
107 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
108 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
109 2858882152 Micromonospora noduli MED15 Isolate Nodule
110 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
111 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
112 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
113 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
114 2867369537 Streptomyces sp. Z26 Isolate Unclassified
115 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
116 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
117 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
118 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
119 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
120 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
121 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
122 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
123 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
124 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
125 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
126 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
127 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
128 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
129 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
130 649633069 Micromonospora sp. L5 Isolate Unclassified
131 8002775197 Frankia nepalensis CN7 Isolate Nodule
132 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
133 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
134 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
135 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
136 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
137 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
138 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
139 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
140 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
141 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
142 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
143 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
144 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 64.6
Metatranscriptomes 0
Isolates 35.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 3.73
Rhizoplane 1.24
Rhizosphere 67.08
Stem 0
Stem Tuber 0
Unclassified 0.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000735 3300003203 Bacteria 15300
2 Ga0070658_10131195 3300005327 Bacteria 2088
3 Ga0070670_100057407 3300005331 Bacteria 3341
4 Ga0070682_100073932 3300005337 Bacteria 2187
5 Ga0070661_100169047 3300005344 Bacteria 1659
6 Ga0070692_10029952 3300005345 Bacteria 2718
7 Ga0070671_100002215 3300005355 Bacteria 15011
8 Ga0070688_100040408 3300005365 Bacteria 2858
9 Ga0070663_100000122 3300005455 Bacteria 36697
10 Ga0070663_100175547 3300005455 Bacteria 1659
11 Ga0070665_100001501 3300005548 Bacteria 27159
12 Ga0068854_100026715 3300005578 Bacteria 3970
13 Ga0068856_100147618 3300005614 Bacteria 2359
14 Ga0068864_100142656 3300005618 Bacteria 2162
15 Ga0068861_100290094 3300005719 Bacteria 1412
16 Ga0068851_10023780 3300005834 Bacteria 2997
17 Ga0068860_100017380 3300005843 Bacteria 7008
18 Ga0068862_100136741 3300005844 Bacteria 2172
19 Ga0081539_10000839 3300005985 Bacteria 59000
20 Ga0070717_10329826 3300006028 Bacteria 1361
21 Ga0068865_100149628 3300006881 Bacteria 1770
22 Ga0105245_10123328 3300009098 Bacteria 2423
23 Ga0105238_10111913 3300009551 Bacteria 2710
24 Ga0157370_10176411 3300013104 Bacteria 1986
25 Ga0183367_1004 3300015688 Bacteria 716880
26 Ga0207688_10022897 3300025901 Bacteria 3420
27 Ga0207645_10098399 3300025907 Bacteria 1886
28 Ga0207643_10109395 3300025908 Bacteria 1627
29 Ga0207644_10009547 3300025931 Bacteria 6372
30 Ga0207706_10046809 3300025933 Bacteria 3828
31 Ga0207691_10030971 3300025940 Bacteria 4996
32 Ga0207658_10161154 3300025986 Bacteria 1839
33 Ga0207639_10054831 3300026041 Bacteria 3048
34 Ga0207678_10000555 3300026067 Bacteria 34090
35 Ga0207678_10048507 3300026067 Bacteria 3671
36 Ga0207678_10140633 3300026067 Bacteria 2060
37 Ga0207648_10063002 3300026089 Bacteria 3232
38 Ga0207683_10174196 3300026121 Bacteria 1949
39 Ga0268266_10017677 3300028379 Bacteria 6080
40 Ga0268264_10012231 3300028381 Bacteria 7060
41 Ga0307515_10000060 3300028794 Bacteria 254768
42 Ga0307515_10164244 3300028794 Bacteria 2247
43 Ga0307511_10000155 3300030521 Bacteria 65410
44 Ga0307513_10101580 3300031456 Bacteria 2897
45 Ga0307513_10110314 3300031456 Bacteria 2747
46 Ga0307513_10147624 3300031456 Bacteria 2267
47 Ga0307508_10021575 3300031616 Bacteria 5857
48 Ga0307516_10000809 3300031730 Bacteria 42907
49 Ga0307516_10049344 3300031730 Bacteria 4137
50 Ga0307516_10160111 3300031730 Bacteria 2002
51 Ga0373942_0009347 3300035207 Bacteria 2293
52 Ga0373925_0117724 3300037068 Bacteria 2059
53 Ga0439436_0029127 3300041404 Bacteria 1609
54 Ga0439449_0019581 3300042007 Bacteria 2537
55 Ga0439457_005499 3300042014 Bacteria 3184
56 Ga0466972_0006536 3300044658 Bacteria 5856
57 Ga0466966_0012412 3300044684 Bacteria 5643
58 Ga0466961_0014782 3300044693 Bacteria 5015
59 Ga0466963_0002234 3300044694 Bacteria 10735
60 Ga0466957_0036830 3300044842 Bacteria 2943
61 Ga0466959_0002021 3300045049 Bacteria 12812
62 Ga0466967_0340708 3300045976 Bacteria 1450
63 Ga0495592_0004256 3300046454 Bacteria 10456
64 Ga0495651_0082523 3300046462 Bacteria 2425
65 Ga0495650_0013979 3300046471 Bacteria 4211
66 Ga0495580_0043622 3300046472 Bacteria 3192
67 Ga0495583_0078315 3300046506 Bacteria 1440
68 Ga0495608_0239545 3300046511 Bacteria 1134
69 Ga0495620_0001407 3300046515 Bacteria 14458
70 Ga0495643_0006035 3300046522 Bacteria 8078
71 Ga0495609_0095676 3300046538 Bacteria 1289
72 Ga0495668_0027579 3300046616 Bacteria 3218
73 Ga0495611_0033348 3300046648 Bacteria 2272
74 Ga0495625_0017874 3300046660 Bacteria 5543
75 Ga0495657_0011092 3300046675 Bacteria 6755
76 Ga0495613_0032048 3300046689 Bacteria 3904
77 Ga0495613_0094475 3300046689 Bacteria 2163
78 Ga0495600_0073752 3300046809 Bacteria 2229
79 Ga0495604_0100066 3300047317 Bacteria 2132
80 Ga0495680_0011052 3300047322 Bacteria 8019
81 Ga0495687_023031 3300047443 Bacteria 2981
82 Ga0495687_029508 3300047443 Bacteria 2537
83 Ga0495685_019754 3300047447 Bacteria 2315
84 Ga0496115_0186162 3300048918 Unclassified 1716
85 Ga0501031_0003849 3300049568 Bacteria 9655
86 Ga0501032_0007977 3300049569 Bacteria 7716
87 Ga0501036_0004728 3300049572 Bacteria 10987
88 Ga0501037_0008201 3300049573 Bacteria 7656
89 Ga0501037_0009880 3300049573 Bacteria 6999
90 Ga0501038_0012601 3300049574 Bacteria 7728
91 Ga0501038_0410929 3300049574 Bacteria 1046
92 Ga0501043_0092285 3300049579 Bacteria 2380
93 Ga0501046_0022581 3300049580 Bacteria 5182
94 Ga0501046_0038447 3300049580 Bacteria 3840
95 Ga0501047_0003449 3300049581 Bacteria 14951
96 Ga0501047_0013157 3300049581 Bacteria 7837
97 Ga0501047_0161851 3300049581 Bacteria 2109
98 Ga0501047_0192537 3300049581 Bacteria 1902
99 Ga0501048_0005383 3300049582 Bacteria 9733
100 Ga0501035_0053133 3300049822 Bacteria 3624
101 Ga0501044_0022992 3300049823 Bacteria 6634
102 Ga0501044_0305096 3300049823 Bacteria 1520
103 Ga0501084_0274347 3300054114 Bacteria 1424
104 Ga0590075_006102 3300059424 Bacteria 2855
105 2547405655 2547132111 Bacteria 8013147
106 2501940687 2501939600 Bacteria 6907073
107 2616699664 2616644814 Bacteria 11555299
108 2643763070 2643221548 Bacteria 8053412
109 2643903551 2643221578 Bacteria 9213798
110 2644409713 2643221673 Bacteria 9196637
111 2644464072 2643221682 Bacteria 6743283
112 2768646357 2767802112 Bacteria 6465194
113 2772641973 2772190715 Bacteria 6959372
114 2784585764 2784132148 Bacteria 8627943
115 2793976793 2791355406 Bacteria 11364898
116 2804846592 2802429296 Bacteria 7227771
117 2809229253 2808606448 Bacteria 8656184
118 2809590413 2808606522 Bacteria 9488490
119 2812361438 2811994879 Bacteria 9313447
120 2812476965 2811994917 Bacteria 7761064
121 2855670968 2855670206 Bacteria 7120389
122 2855681215 2855676851 Bacteria 7063653
123 2856862778 2856858025 Bacteria 7255264
124 2857294045 2857288857 Bacteria 7189066
125 2858851795 2858848962 Bacteria 6963058
126 2858882708 2858882152 Bacteria 7230291
127 2858894881 2858888857 Bacteria 7060307
128 2858899881 2858895516 Bacteria 7378898
129 2862296530 2862290372 Bacteria 7471434
130 2866614357 2866612099 Bacteria 7543886
131 2867370157 2867369537 Bacteria 6501581
132 2869054246 2869048445 Bacteria 6875584
133 2869066304 2869061728 Bacteria 7112407
134 2873151935 2873151551 Bacteria 8625867
135 2873320563 2873314349 Bacteria 8512634
136 2880490675 2880489317 Bacteria 7096270
137 2880501901 2880495981 Bacteria 7340502
138 2884703372 2884693830 Bacteria 11273186
139 2891398364 2891395885 Bacteria 9251614
140 2891559181 2891554331 Bacteria 8812224
141 2895429871 2895427314 Bacteria 13147766
142 2895443603 2895442618 Bacteria 11027144
143 2929230423 2929226422 Bacteria 7248583
144 2946052926 2946045630 Bacteria 8527308
145 2946064692 2946064051 Bacteria 8957905
146 2947224666 2947224130 Bacteria 9938529
147 649815451 649633069 Bacteria 6962533
148 8002780068 8002775197 Bacteria 10728764
149 8003323781 8003314358 Bacteria 10575343
150 8023626478 8023623736 Bacteria 8593882
151 8025415064 8025413630 Bacteria 7014048
152 8025531821 8025530807 Bacteria 8495698
153 8047710649 8047710418 Bacteria 11023148
154 8047903633 8047893842 Bacteria 11723082
155 8048356895 8048356638 Bacteria 11044339
156 8048378930 8048369669 Bacteria 11666822
157 8048388033 8048379754 Bacteria 11877923
158 8054705658 8054704163 Bacteria 7247792
159 8054733883 8054727385 Bacteria 7558670
160 8054735479 8054734606 Bacteria 6947278
161 8056215027 8056207758 Bacteria 8639239
162 JGI25406J46586_10000735
163 Ga0070658_10131195
164 Ga0070670_100057407
165 Ga0070682_100073932
166 Ga0070661_100169047
167 Ga0070692_10029952
168 Ga0070671_100002215
169 Ga0070688_100040408
170 Ga0070663_100000122
171 Ga0070663_100175547
172 Ga0070665_100001501
173 Ga0068854_100026715
174 Ga0068856_100147618
175 Ga0068864_100142656
176 Ga0068861_100290094
177 Ga0068851_10023780
178 Ga0068860_100017380
179 Ga0068862_100136741
180 Ga0081539_10000839
181 Ga0070717_10329826
182 Ga0068865_100149628
183 Ga0105245_10123328
184 Ga0105238_10111913
185 Ga0157370_10176411
186 Ga0183367_1004
187 Ga0207688_10022897
188 Ga0207645_10098399
189 Ga0207643_10109395
190 Ga0207644_10009547
191 Ga0207706_10046809
192 Ga0207691_10030971
193 Ga0207658_10161154
194 Ga0207639_10054831
195 Ga0207678_10000555
196 Ga0207678_10048507
197 Ga0207678_10140633
198 Ga0207648_10063002
199 Ga0207683_10174196
200 Ga0268266_10017677
201 Ga0268264_10012231
202 Ga0307515_10000060
203 Ga0307515_10164244
204 Ga0307511_10000155
205 Ga0307513_10101580
206 Ga0307513_10110314
207 Ga0307513_10147624
208 Ga0307508_10021575
209 Ga0307516_10000809
210 Ga0307516_10049344
211 Ga0307516_10160111
212 Ga0373942_0009347
213 Ga0373925_0117724
214 Ga0439436_0029127
215 Ga0439449_0019581
216 Ga0439457_005499
217 Ga0466972_0006536
218 Ga0466966_0012412
219 Ga0466961_0014782
220 Ga0466963_0002234
221 Ga0466957_0036830
222 Ga0466959_0002021
223 Ga0466967_0340708
224 Ga0495592_0004256
225 Ga0495651_0082523
226 Ga0495650_0013979
227 Ga0495580_0043622
228 Ga0495583_0078315
229 Ga0495608_0239545
230 Ga0495620_0001407
231 Ga0495643_0006035
232 Ga0495609_0095676
233 Ga0495668_0027579
234 Ga0495611_0033348
235 Ga0495625_0017874
236 Ga0495657_0011092
237 Ga0495613_0032048
238 Ga0495613_0094475
239 Ga0495600_0073752
240 Ga0495604_0100066
241 Ga0495680_0011052
242 Ga0495687_023031
243 Ga0495687_029508
244 Ga0495685_019754
245 Ga0496115_0186162
246 Ga0501031_0003849
247 Ga0501032_0007977
248 Ga0501036_0004728
249 Ga0501037_0008201
250 Ga0501037_0009880
251 Ga0501038_0012601
252 Ga0501038_0410929
253 Ga0501043_0092285
254 Ga0501046_0022581
255 Ga0501046_0038447
256 Ga0501047_0003449
257 Ga0501047_0013157
258 Ga0501047_0161851
259 Ga0501047_0192537
260 Ga0501048_0005383
261 Ga0501035_0053133
262 Ga0501044_0022992
263 Ga0501044_0305096
264 Ga0501084_0274347
265 Ga0590075_006102
266 2547405655
267 2501940687
268 2616699664
269 2643763070
270 2643903551
271 2644409713
272 2644464072
273 2768646357
274 2772641973
275 2784585764
276 2793976793
277 2804846592
278 2809229253
279 2809590413
280 2812361438
281 2812476965
282 2855670968
283 2855681215
284 2856862778
285 2857294045
286 2858851795
287 2858882708
288 2858894881
289 2858899881
290 2862296530
291 2866614357
292 2867370157
293 2869054246
294 2869066304
295 2873151935
296 2873320563
297 2880490675
298 2880501901
299 2884703372
300 2891398364
301 2891559181
302 2895429871
303 2895443603
304 2929230423
305 2946052926
306 2946064692
307 2947224666
308 649815451
309 8002780068
310 8003323781
311 8023626478
312 8025415064
313 8025531821
314 8047710649
315 8047903633
316 8048356895
317 8048378930
318 8048388033
319 8054705658
320 8054733883
321 8054735479
322 8056215027

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06224

AlkZ-like

DNA glycosylase AlkZ-like

49

368

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uuj-assembly1.cif.gz_A streptomyces sahachiroi dna glycosylase alkz 0.8106 1 358
5uuj-assembly1.cif.gz_A streptomyces sahachiroi dna glycosylase alkz 0.8086 1 358
8ur2-assembly1.cif.gz_B crystal structure of macrophage migration inhibitory factor (mif) from trichomonas vaginalis (i41 form) 0.7044 319 358
6vvm-assembly1.cif.gz_C r7 fused 4-ot wild type asymmetric trimer 0.6951 319 358
6blm-assembly1.cif.gz_C crystal structure of native fused 4-ot 0.6921 319 358
ID Description Score Start End Superfamily
af_Q8IG67_4_81_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.7259 229 254 1.10.10.10
af_I1JE36_656_727_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.7133 113 181 1.10.10.10
3qovC02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain 0.7076 319 358 3.30.300.30
af_Q54T18_540_611_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.6876 201 256 1.10.10.10
af_Q07171_185_301_3.40.20.10 Alpha Beta;3-Layer(aba) Sandwich;Severin;Severin 0.6864 311 358 3.40.20.10
ID Description Score Start End GO Terms
AF-A0A2G6XMT2-F1-model_v4 deleted 0.9871 1 358
AF-A0A3N6EBU2-F1-model_v4 deleted 0.9864 1 358
AF-A0A1H5RHF4-F1-model_v4 Winged helix DNA-binding domain-containing protein 0.9855 1 356 GO:0003677
AF-A0A2G6XMT2-F1-model_v4 deleted 0.9844 1 358
AF-A0A7K3PHT1-F1-model_v4 Winged helix DNA-binding domain-containing protein 0.9842 4 188 GO:0003677

Map