F237951

General Info

Members Datasets Scaffolds Average Seq Length
161 130 153 248

Family's Representative Sequence

Representative Sequence 3300050494|nmdc:mga06z11_374_c1|nmdc:mga06z11_374_c1_13506_14348
Length 280
Sequence VARVNLLRFDLTGEVLRATRGGMCAQEDQMSTVVFAPGGYRYIPGMXXXSGGVAAEAGFRIERVRFRKPVPLMAGFRRIEKIIGEAGRPMTSFCACELRSPEPFTEAGFVAFNQHYVGTLADWRVYDPATKVNPVARSNVCPEIHKPAEPSFHAFSFTVAEKDATPSFIISGSGEAPEGRGNYGKYVVRPGDTSAEGMREKARAVLGEMERRMGLLGFTWREVTATQVYTVHAQHSFLADEIVRRGAAEHGLSWHFCRPPVVGLDYEMDVRHVSVERVID

Samples

Sample ID Description Type Environment
1 2643221736 Bosea sp. Root483D1 Isolate Unclassified
2 2841760612 Bosea sp. Tri-49 Isolate Nodule
3 2844104063 Bosea sp. Tri-39 Isolate Nodule
4 2851182111 Bosea sp. Tri-44 Isolate Nodule
5 2851246043 Bosea sp. Tri-54 Isolate Nodule
6 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
7 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
53 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
54 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
56 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
70 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
73 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
74 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
75 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
76 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
77 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
78 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
79 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
80 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
81 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
82 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
83 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
84 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
85 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
86 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
87 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
91 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
92 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
93 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
94 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
95 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
96 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
99 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
100 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
101 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
102 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
103 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
104 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
105 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
106 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
107 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
108 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
109 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
110 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
111 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
112 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
113 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
114 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
115 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
116 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
117 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
118 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
119 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
120 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
121 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
122 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
123 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
124 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
125 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
126 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
127 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
128 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
129 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
130 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.03
Metatranscriptomes 0
Isolates 4.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.15
Nodule 2.48
Rhizoplane 10.56
Rhizosphere 63.35
Stem 0
Stem Tuber 0
Unclassified 7.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10001533 3300003203 Bacteria 10914
2 JGI25406J46586_10012721 3300003203 Bacteria 3637
3 rootH1_10202244 3300003323 Bacteria 2897
4 Ga0065715_10101597 3300005293 Bacteria 3188
5 Ga0068869_100035251 3300005334 Bacteria 3545
6 Ga0070666_10356165 3300005335 Bacteria 1048
7 Ga0068868_100678938 3300005338 Bacteria 920
8 Ga0070668_100024703 3300005347 Bacteria 4554
9 Ga0070668_100059920 3300005347 Bacteria 2947
10 Ga0070668_100662798 3300005347 Bacteria 918
11 Ga0070675_100428826 3300005354 Bacteria 1183
12 Ga0070667_100194040 3300005367 Bacteria 1800
13 Ga0070711_100258416 3300005439 Bacteria 1369
14 Ga0070681_10100693 3300005458 Bacteria 2835
15 Ga0070684_100083770 3300005535 Bacteria 2826
16 Ga0068853_100254776 3300005539 Bacteria 1612
17 Ga0070695_100010693 3300005545 Bacteria 5484
18 Ga0070695_100089633 3300005545 Bacteria 2051
19 Ga0070696_100093346 3300005546 Bacteria 2146
20 Ga0070696_100211140 3300005546 Bacteria 1453
21 Ga0070665_100080131 3300005548 Bacteria 3270
22 Ga0068856_100224322 3300005614 Bacteria 1894
23 Ga0068851_10194124 3300005834 Bacteria 1130
24 Ga0068858_100749914 3300005842 Bacteria 951
25 Ga0068862_100173966 3300005844 Bacteria 1929
26 Ga0081538_10013198 3300005981 Bacteria 6557
27 Ga0081539_10001341 3300005985 Bacteria 42889
28 Ga0081539_10018606 3300005985 Bacteria 4810
29 Ga0075365_10005444 3300006038 Bacteria 6865
30 Ga0075368_10023389 3300006042 Bacteria 2360
31 Ga0075363_100032372 3300006048 Bacteria 2715
32 Ga0075363_100047483 3300006048 Unclassified 2280
33 Ga0075364_10013696 3300006051 Bacteria 4994
34 Ga0075367_10002266 3300006178 Bacteria 8713
35 Ga0075367_10004456 3300006178 Bacteria 6842
36 Ga0075367_10050888 3300006178 Bacteria 2447
37 Ga0075367_10126345 3300006178 Bacteria 1578
38 Ga0075428_100259712 3300006844 Bacteria 1870
39 Ga0075433_10029672 3300006852 Bacteria 4662
40 Ga0075433_10114377 3300006852 Bacteria 2394
41 Ga0075434_100015591 3300006871 Bacteria 7294
42 Ga0075435_100037938 3300007076 Bacteria 3840
43 Ga0099794_10003053 3300007265 Bacteria 6322
44 Ga0111539_10595758 3300009094 Bacteria 1287
45 Ga0105247_10064820 3300009101 Bacteria 2271
46 Ga0114129_10001230 3300009147 Bacteria 34074
47 Ga0105243_10339087 3300009148 Bacteria 1376
48 Ga0105237_10117297 3300009545 Bacteria 2656
49 Ga0105238_10011620 3300009551 Bacteria 8869
50 Ga0105249_10008747 3300009553 Bacteria 8834
51 Ga0099796_10038685 3300010159 Bacteria 1602
52 Ga0105239_10247247 3300010375 Bacteria 2003
53 Ga0157378_10522212 3300013297 Bacteria 1189
54 Ga0163163_10293696 3300014325 Bacteria 1677
55 Ga0157380_10023957 3300014326 Bacteria 4613
56 Ga0157377_10037674 3300014745 Bacteria 2665
57 Ga0213876_10046011 3300021384 Bacteria 2307
58 Ga0209563_103532 3300025230 Bacteria 3204
59 Ga0209758_1000651 3300025297 Bacteria 52531
60 Ga0207710_10231057 3300025900 Bacteria 920
61 Ga0207660_10241047 3300025917 Bacteria 1424
62 Ga0207694_10166984 3300025924 Bacteria 1780
63 Ga0207712_10009793 3300025961 Bacteria 6073
64 Ga0207668_10081416 3300025972 Bacteria 2349
65 Ga0207658_10249648 3300025986 Unclassified 1507
66 Ga0207677_10474858 3300026023 Bacteria 1076
67 Ga0207708_10301732 3300026075 Unclassified 1303
68 Ga0207641_10087212 3300026088 Bacteria 2723
69 Ga0207676_10392712 3300026095 Bacteria 1294
70 Ga0207675_100036917 3300026118 Bacteria 4558
71 Ga0207675_100135393 3300026118 Bacteria 2337
72 Ga0209998_10015691 3300027717 Bacteria 1589
73 Ga0209974_10099684 3300027876 Unclassified 1014
74 Ga0207428_10044480 3300027907 Bacteria 3582
75 Ga0268265_10091713 3300028380 Bacteria 2430
76 Ga0268264_10403930 3300028381 Bacteria 1313
77 Ga0307517_10165026 3300028786 Bacteria 1474
78 Ga0307408_100497562 3300031548 Bacteria 1066
79 Ga0307405_10567820 3300031731 Bacteria 921
80 Ga0307409_100838939 3300031995 Bacteria 929
81 Ga0373958_0006578 3300034819 Bacteria 1817
82 Ga0373928_0003840 3300035084 Bacteria 2864
83 Ga0373940_0013145 3300035088 Bacteria 1996
84 Ga0373932_0004338 3300035112 Bacteria 3362
85 Ga0373939_0001038 3300035114 Bacteria 6849
86 Ga0373939_0010230 3300035114 Bacteria 2340
87 Ga0373960_0036217 3300035121 Bacteria 1404
88 Ga0373943_0042850 3300035170 Bacteria 2195
89 Ga0373961_0010787 3300035241 Bacteria 2258
90 Ga0373961_0067222 3300035241 Bacteria 1101
91 Ga0373962_0002568 3300035242 Bacteria 4309
92 Ga0373931_0003765 3300035691 Bacteria 6858
93 Ga0373927_0049706 3300035695 Bacteria 2711
94 Ga0373937_0268906 3300036401 Bacteria 1609
95 Ga0373925_0178620 3300037068 Bacteria 1679
96 Ga0395898_0480461 3300037466 Bacteria 1182
97 Ga0436364_0076977 3300037853 Bacteria 1366
98 Ga0436365_0222218 3300039437 Bacteria 8871
99 Ga0436360_0327032 3300039438 Bacteria 2200
100 Ga0436363_0852909 3300039450 Bacteria 3610
101 Ga0436362_0518132 3300039453 Bacteria 1249
102 Ga0453683_0159359 3300044673 Bacteria 1428
103 Ga0466963_0057293 3300044694 Bacteria 2595
104 Ga0466967_0941207 3300045976 Bacteria 860
105 Ga0495603_0050113 3300046455 Bacteria 2484
106 Ga0495603_0115827 3300046455 Bacteria 1563
107 Ga0495629_0083192 3300046459 Bacteria 2234
108 Ga0495594_0129156 3300046499 Bacteria 1431
109 Ga0495672_0240415 3300047320 Bacteria 884
110 Ga0495686_0087366 3300047472 Bacteria 1896
111 Ga0496104_0006466 3300048907 Bacteria 10301
112 Ga0496104_0031953 3300048907 Bacteria 4898
113 Ga0496105_0006116 3300048908 Bacteria 9216
114 Ga0496105_0048106 3300048908 Bacteria 3520
115 Ga0496106_0115254 3300048909 Bacteria 2095
116 Ga0496108_0005523 3300048911 Bacteria 10227
117 Ga0496108_0365575 3300048911 Bacteria 1259
118 Ga0496109_0039106 3300048912 Bacteria 4292
119 Ga0496109_0226916 3300048912 Bacteria 1757
120 Ga0496110_0023893 3300048913 Bacteria 5204
121 Ga0496111_0061755 3300048914 Unclassified 2716
122 Ga0496112_0008371 3300048915 Bacteria 9263
123 Ga0496112_0010540 3300048915 Bacteria 8392
124 Ga0496112_0077516 3300048915 Bacteria 3287
125 Ga0496112_0451055 3300048915 Bacteria 1224
126 Ga0496113_0002592 3300048916 Bacteria 10561
127 Ga0496115_0113624 3300048918 Bacteria 2225
128 Ga0496125_0007638 3300048928 Bacteria 11467
129 Ga0496126_0070615 3300048929 Bacteria 3111
130 Ga0496126_0078323 3300048929 Bacteria 2929
131 nmdc:mga03n38_12053_c1 3300050490 Bacteria 3242
132 nmdc:mga00v17_663_c1 3300050491 Bacteria 18944
133 nmdc:mga0yw44_131360_c1 3300050492 Bacteria 1621
134 nmdc:mga06z11_1221_c1 3300050494 Bacteria 9490
135 nmdc:mga06z11_122665_c1 3300050494 Bacteria 1451
136 nmdc:mga06z11_21602_c1 3300050494 Bacteria 2994
137 nmdc:mga06z11_24353_c1 3300050494 Bacteria 2855
138 nmdc:mga06z11_374_c1 3300050494 Bacteria 16845
139 nmdc:mga04h51_183353_c1 3300050495 Bacteria 816
140 nmdc:mga04h51_24007_c1 3300050495 Bacteria 1863
141 nmdc:mga07m45_27672_c1 3300050496 Bacteria 3125
142 nmdc:mga05p37_938_c1 3300050507 Bacteria 32835
143 nmdc:mga08y16_19131_c1 3300050511 Bacteria 7216
144 nmdc:mga0n895_11553_c1 3300050512 Bacteria 7887
145 nmdc:mga0n895_91521_c1 3300050512 Bacteria 3044
146 nmdc:mga0rr50_356475_c1 3300050513 Bacteria 1231
147 nmdc:mga0rr50_6215_c1 3300050513 Bacteria 7239
148 nmdc:mga0a205_604751_c1 3300050515 Bacteria 949
149 nmdc:mga0a205_64981_c1 3300050515 Bacteria 3525
150 Ga0500641_0007425 3300053096 Bacteria 3909
151 Ga0500568_0104552 3300053139 Bacteria 1061
152 Ga0500616_0033263 3300053153 Bacteria 2813
153 Ga0500638_023142 3300053162 Bacteria 2950

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046499 Ga0495594_0129156 Ga0495594_0129156_10_687 225
2 3300007265 Ga0099794_10003053 Ga0099794_100030534 227
3 3300053096 Ga0500641_0007425 Ga0500641_0007425_92_835 230
4 3300046455 Ga0495603_0050113 Ga0495603_0050113_1776_2474 232
5 3300046455 Ga0495603_0115827 Ga0495603_0115827_30_728 232
6 3300050515 nmdc:mga0a205_604751_c1 nmdc:mga0a205_604751_c1_88_792 232
7 3300006852 Ga0075433_10029672 Ga0075433_100296727 234
8 3300006871 Ga0075434_100015591 Ga0075434_10001559110 234
9 3300007076 Ga0075435_100037938 Ga0075435_1000379382 234
10 3300009147 Ga0114129_10001230 Ga0114129_1000123014 234
11 3300050507 nmdc:mga05p37_938_c1 nmdc:mga05p37_938_c1_8810_9586 234
12 3300050512 nmdc:mga0n895_11553_c1 nmdc:mga0n895_11553_c1_1611_2387 234
13 3300050513 nmdc:mga0rr50_6215_c1 nmdc:mga0rr50_6215_c1_1614_2390 234
14 3300050515 nmdc:mga0a205_64981_c1 nmdc:mga0a205_64981_c1_2035_2811 234
15 3300005548 Ga0070665_100080131 Ga0070665_1000801312 236
16 3300010159 Ga0099796_10038685 Ga0099796_100386851 236
17 3300021384 Ga0213876_10046011 Ga0213876_100460112 236
18 3300039437 Ga0436365_0222218 Ga0436365_0222218_2463_3218 236
19 3300005535 Ga0070684_100083770 Ga0070684_1000837702 237
20 3300005545 Ga0070695_100089633 Ga0070695_1000896333 237
21 3300005842 Ga0068858_100749914 Ga0068858_1007499141 237
22 3300009545 Ga0105237_10117297 Ga0105237_101172973 237
23 3300009551 Ga0105238_10011620 Ga0105238_100116204 237
24 3300025924 Ga0207694_10166984 Ga0207694_101669842 237
25 3300037853 Ga0436364_0076977 Ga0436364_0076977_525_1274 237
26 3300039453 Ga0436362_0518132 Ga0436362_0518132_115_864 237
27 3300035170 Ga0373943_0042850 Ga0373943_0042850_427_1179 238
28 3300035695 Ga0373927_0049706 Ga0373927_0049706_499_1251 238
29 3300037068 Ga0373925_0178620 Ga0373925_0178620_910_1662 238
30 3300005614 Ga0068856_100224322 Ga0068856_1002243222 244
31 3300044694 Ga0466963_0057293 Ga0466963_0057293_868_1617 244
32 iso_pu_bacteria 2894772417 2894772888 244
33 iso_pu_bacteria 8045864390 8045866720 244
34 iso_pu_bacteria 2643221736 2644743139 245
35 iso_pu_bacteria 2841760612 2841761133 245
36 iso_pu_bacteria 2844104063 2844104158 245
37 iso_pu_bacteria 2851182111 2851184141 245
38 iso_pu_bacteria 2851246043 2851247146 245
39 iso_pu_bacteria 2888388044 2888388276 245
40 3300003203 JGI25406J46586_10012721 JGI25406J46586_100127213 246
41 3300005985 Ga0081539_10001341 Ga0081539_1000134124 246
42 3300048915 Ga0496112_0451055 Ga0496112_0451055_38_784 246
43 3300003203 JGI25406J46586_10001533 JGI25406J46586_100015335 247
44 3300003323 rootH1_10202244 rootH1_102022443 247
45 3300005293 Ga0065715_10101597 Ga0065715_101015973 247
46 3300005334 Ga0068869_100035251 Ga0068869_1000352514 247
47 3300005335 Ga0070666_10356165 Ga0070666_103561651 247
48 3300005338 Ga0068868_100678938 Ga0068868_1006789381 247
49 3300005347 Ga0070668_100024703 Ga0070668_1000247034 247
50 3300005347 Ga0070668_100059920 Ga0070668_1000599202 247
51 3300005347 Ga0070668_100662798 Ga0070668_1006627982 247
52 3300005354 Ga0070675_100428826 Ga0070675_1004288262 247
53 3300005367 Ga0070667_100194040 Ga0070667_1001940402 247
54 3300005439 Ga0070711_100258416 Ga0070711_1002584162 247
55 3300005458 Ga0070681_10100693 Ga0070681_101006932 247
56 3300005539 Ga0068853_100254776 Ga0068853_1002547762 247
57 3300005545 Ga0070695_100010693 Ga0070695_1000106932 247
58 3300005546 Ga0070696_100093346 Ga0070696_1000933463 247
59 3300005546 Ga0070696_100211140 Ga0070696_1002111401 247
60 3300005834 Ga0068851_10194124 Ga0068851_101941243 247
61 3300005844 Ga0068862_100173966 Ga0068862_1001739662 247
62 3300005981 Ga0081538_10013198 Ga0081538_100131982 247
63 3300005985 Ga0081539_10018606 Ga0081539_100186063 247
64 3300006038 Ga0075365_10005444 Ga0075365_100054445 247
65 3300006042 Ga0075368_10023389 Ga0075368_100233891 247
66 3300006048 Ga0075363_100032372 Ga0075363_1000323722 247
67 3300006048 Ga0075363_100047483 Ga0075363_1000474832 247
68 3300006051 Ga0075364_10013696 Ga0075364_100136964 247
69 3300006178 Ga0075367_10002266 Ga0075367_100022669 247
70 3300006178 Ga0075367_10004456 Ga0075367_100044564 247
71 3300006178 Ga0075367_10050888 Ga0075367_100508883 247
72 3300006178 Ga0075367_10126345 Ga0075367_101263452 247
73 3300006844 Ga0075428_100259712 Ga0075428_1002597123 247
74 3300006852 Ga0075433_10114377 Ga0075433_101143771 247
75 3300009094 Ga0111539_10595758 Ga0111539_105957582 247
76 3300009101 Ga0105247_10064820 Ga0105247_100648202 247
77 3300009148 Ga0105243_10339087 Ga0105243_103390872 247
78 3300009553 Ga0105249_10008747 Ga0105249_100087475 247
79 3300010375 Ga0105239_10247247 Ga0105239_102472471 247
80 3300013297 Ga0157378_10522212 Ga0157378_105222121 247
81 3300014325 Ga0163163_10293696 Ga0163163_102936961 247
82 3300014326 Ga0157380_10023957 Ga0157380_100239573 247
83 3300014745 Ga0157377_10037674 Ga0157377_100376741 247
84 3300025230 Ga0209563_103532 Ga0209563_1035322 247
85 3300025297 Ga0209758_1000651 Ga0209758_100065147 247
86 3300025900 Ga0207710_10231057 Ga0207710_102310571 247
87 3300025917 Ga0207660_10241047 Ga0207660_102410472 247
88 3300025961 Ga0207712_10009793 Ga0207712_100097933 247
89 3300025972 Ga0207668_10081416 Ga0207668_100814163 247
90 3300025986 Ga0207658_10249648 Ga0207658_102496482 247
91 3300026023 Ga0207677_10474858 Ga0207677_104748582 247
92 3300026075 Ga0207708_10301732 Ga0207708_103017322 247
93 3300026088 Ga0207641_10087212 Ga0207641_100872122 247
94 3300026095 Ga0207676_10392712 Ga0207676_103927122 247
95 3300026118 Ga0207675_100036917 Ga0207675_1000369175 247
96 3300026118 Ga0207675_100135393 Ga0207675_1001353933 247
97 3300027717 Ga0209998_10015691 Ga0209998_100156912 247
98 3300027876 Ga0209974_10099684 Ga0209974_100996842 247
99 3300027907 Ga0207428_10044480 Ga0207428_100444802 247
100 3300028380 Ga0268265_10091713 Ga0268265_100917132 247
101 3300028381 Ga0268264_10403930 Ga0268264_104039302 247
102 3300028786 Ga0307517_10165026 Ga0307517_101650262 247
103 3300031548 Ga0307408_100497562 Ga0307408_1004975621 247
104 3300031731 Ga0307405_10567820 Ga0307405_105678201 247
105 3300031995 Ga0307409_100838939 Ga0307409_1008389391 247
106 3300034819 Ga0373958_0006578 Ga0373958_0006578_174_926 247
107 3300035084 Ga0373928_0003840 Ga0373928_0003840_1934_2686 247
108 3300035088 Ga0373940_0013145 Ga0373940_0013145_258_1010 247
109 3300035112 Ga0373932_0004338 Ga0373932_0004338_1987_2739 247
110 3300035114 Ga0373939_0001038 Ga0373939_0001038_1185_1937 247
111 3300035114 Ga0373939_0010230 Ga0373939_0010230_504_1256 247
112 3300035121 Ga0373960_0036217 Ga0373960_0036217_491_1243 247
113 3300035241 Ga0373961_0010787 Ga0373961_0010787_1215_1967 247
114 3300035241 Ga0373961_0067222 Ga0373961_0067222_321_1073 247
115 3300035242 Ga0373962_0002568 Ga0373962_0002568_3448_4200 247
116 3300035691 Ga0373931_0003765 Ga0373931_0003765_4281_5033 247
117 3300036401 Ga0373937_0268906 Ga0373937_0268906_822_1574 247
118 3300037466 Ga0395898_0480461 Ga0395898_0480461_412_1155 247
119 3300039438 Ga0436360_0327032 Ga0436360_0327032_112_903 247
120 3300039450 Ga0436363_0852909 Ga0436363_0852909_33_776 247
121 3300044673 Ga0453683_0159359 Ga0453683_0159359_195_947 247
122 3300045976 Ga0466967_0941207 Ga0466967_0941207_87_845 247
123 3300046459 Ga0495629_0083192 Ga0495629_0083192_766_1509 247
124 3300047320 Ga0495672_0240415 Ga0495672_0240415_52_807 247
125 3300047472 Ga0495686_0087366 Ga0495686_0087366_814_1557 247
126 3300048907 Ga0496104_0006466 Ga0496104_0006466_1711_2460 247
127 3300048907 Ga0496104_0031953 Ga0496104_0031953_181_936 247
128 3300048908 Ga0496105_0006116 Ga0496105_0006116_7263_8012 247
129 3300048908 Ga0496105_0048106 Ga0496105_0048106_409_1164 247
130 3300048909 Ga0496106_0115254 Ga0496106_0115254_772_1527 247
131 3300048911 Ga0496108_0005523 Ga0496108_0005523_1944_2693 247
132 3300048911 Ga0496108_0365575 Ga0496108_0365575_19_774 247
133 3300048912 Ga0496109_0039106 Ga0496109_0039106_1735_2484 247
134 3300048912 Ga0496109_0226916 Ga0496109_0226916_203_958 247
135 3300048913 Ga0496110_0023893 Ga0496110_0023893_4156_4905 247
136 3300048914 Ga0496111_0061755 Ga0496111_0061755_1778_2527 247
137 3300048915 Ga0496112_0008371 Ga0496112_0008371_3695_4450 247
138 3300048915 Ga0496112_0010540 Ga0496112_0010540_5052_5801 247
139 3300048915 Ga0496112_0077516 Ga0496112_0077516_1107_1850 247
140 3300048916 Ga0496113_0002592 Ga0496113_0002592_2405_3154 247
141 3300048918 Ga0496115_0113624 Ga0496115_0113624_14_769 247
142 3300048928 Ga0496125_0007638 Ga0496125_0007638_10235_10984 247
143 3300048929 Ga0496126_0070615 Ga0496126_0070615_2321_3070 247
144 3300048929 Ga0496126_0078323 Ga0496126_0078323_11_802 247
145 3300050490 nmdc:mga03n38_12053_c1 nmdc:mga03n38_12053_c1_1328_2077 247
146 3300050491 nmdc:mga00v17_663_c1 nmdc:mga00v17_663_c1_12704_13453 247
147 3300050492 nmdc:mga0yw44_131360_c1 nmdc:mga0yw44_131360_c1_405_1154 247
148 3300050494 nmdc:mga06z11_1221_c1 nmdc:mga06z11_1221_c1_4802_5551 247
149 3300050494 nmdc:mga06z11_122665_c1 nmdc:mga06z11_122665_c1_431_1186 247
150 3300050494 nmdc:mga06z11_21602_c1 nmdc:mga06z11_21602_c1_1520_2269 247
151 3300050494 nmdc:mga06z11_24353_c1 nmdc:mga06z11_24353_c1_1499_2248 247
152 3300050494 nmdc:mga06z11_374_c1 nmdc:mga06z11_374_c1_13506_14348 247
153 3300050495 nmdc:mga04h51_183353_c1 nmdc:mga04h51_183353_c1_23_772 247
154 3300050495 nmdc:mga04h51_24007_c1 nmdc:mga04h51_24007_c1_55_804 247
155 3300050496 nmdc:mga07m45_27672_c1 nmdc:mga07m45_27672_c1_1783_2625 247
156 3300050511 nmdc:mga08y16_19131_c1 nmdc:mga08y16_19131_c1_215_970 247
157 3300050512 nmdc:mga0n895_91521_c1 nmdc:mga0n895_91521_c1_1934_2686 247
158 3300050513 nmdc:mga0rr50_356475_c1 nmdc:mga0rr50_356475_c1_413_1165 247
159 3300053139 Ga0500568_0104552 Ga0500568_0104552_135_890 247
160 3300053153 Ga0500616_0033263 Ga0500616_0033263_1090_1836 247
161 3300053162 Ga0500638_023142 Ga0500638_023142_1643_2446 247

Structural Annotation

Top 5 Hits

ID Description Score Start End
6l8p-assembly1.cif.gz_B crystal structure of rida from antarctic bacterium psychrobacter sp. pamc 21119 0.7701 135 242
2dyy-assembly4.cif.gz_J crystal structure of putative translation initiation inhibitor ph0854 from pyrococcus horikoshii 0.7474 135 243
2dyy-assembly2.cif.gz_E crystal structure of putative translation initiation inhibitor ph0854 from pyrococcus horikoshii 0.7473 135 241
2b33-assembly1.cif.gz_A crystal structure of a putative endoribonuclease (tm0215) from thermotoga maritima msb8 at 2.30 a resolution 0.746 135 243
1xrg-assembly1.cif.gz_A conserved hypothetical protein from clostridium thermocellum cth-2968 0.7422 135 241
ID Description Score Start End Superfamily
3k0tB00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.742 135 242 3.30.1330.40
af_A0A1D8PGY1_281_387_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.7419 43 127 3.30.1330.40
3gtzB00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.7397 135 242 3.30.1330.40
1nq3C00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.7383 135 241 3.30.1330.40
2dyyG00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.7263 135 243 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A533J4E5-F1-model_v4 deleted 1 1 247
AF-A0A4Q4K555-F1-model_v4 deleted 0.9987 1 247
AF-A0A537ULS4-F1-model_v4 Uncharacterized protein 0.9973 1 247
AF-A0A6G8ZGT3-F1-model_v4 deleted 0.997 1 247
AF-A0A4Q5PP68-F1-model_v4 RidA family protein 0.9964 1 247

Feature Viewer

pLDDT pTM Quality
93.95 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map