F237951
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 161 | 130 | 153 | 248 |
Family's Representative Sequence
| Representative Sequence | 3300050494|nmdc:mga06z11_374_c1|nmdc:mga06z11_374_c1_13506_14348 |
| Length | 280 |
| Sequence | VARVNLLRFDLTGEVLRATRGGMCAQEDQMSTVVFAPGGYRYIPGMXXXSGGVAAEAGFRIERVRFRKPVPLMAGFRRIEKIIGEAGRPMTSFCACELRSPEPFTEAGFVAFNQHYVGTLADWRVYDPATKVNPVARSNVCPEIHKPAEPSFHAFSFTVAEKDATPSFIISGSGEAPEGRGNYGKYVVRPGDTSAEGMREKARAVLGEMERRMGLLGFTWREVTATQVYTVHAQHSFLADEIVRRGAAEHGLSWHFCRPPVVGLDYEMDVRHVSVERVID |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 2 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 3 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 4 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 5 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 6 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 7 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 8 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 9 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 21 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 25 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 26 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 27 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 28 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 29 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 30 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 31 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 32 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 33 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 34 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 35 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 36 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 37 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 38 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 39 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 40 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 48 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 54 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 70 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 73 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 74 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 75 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 76 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 77 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 78 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 79 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 80 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 81 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 82 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 83 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 84 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 85 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 86 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 87 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 88 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 89 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 90 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 91 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 92 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 93 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 94 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 95 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 96 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 97 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 98 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 104 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 105 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 106 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 107 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 108 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 109 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 110 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 111 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 112 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 113 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 114 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 115 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 116 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 117 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 118 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 119 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 120 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 121 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 122 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 123 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 124 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 125 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 126 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 127 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 128 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 129 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 130 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.03 |
| Metatranscriptomes | 0 |
| Isolates | 4.97 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.15 |
| Nodule | 2.48 |
| Rhizoplane | 10.56 |
| Rhizosphere | 63.35 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10001533 | 3300003203 | Bacteria | 10914 |
| 2 | JGI25406J46586_10012721 | 3300003203 | Bacteria | 3637 |
| 3 | rootH1_10202244 | 3300003323 | Bacteria | 2897 |
| 4 | Ga0065715_10101597 | 3300005293 | Bacteria | 3188 |
| 5 | Ga0068869_100035251 | 3300005334 | Bacteria | 3545 |
| 6 | Ga0070666_10356165 | 3300005335 | Bacteria | 1048 |
| 7 | Ga0068868_100678938 | 3300005338 | Bacteria | 920 |
| 8 | Ga0070668_100024703 | 3300005347 | Bacteria | 4554 |
| 9 | Ga0070668_100059920 | 3300005347 | Bacteria | 2947 |
| 10 | Ga0070668_100662798 | 3300005347 | Bacteria | 918 |
| 11 | Ga0070675_100428826 | 3300005354 | Bacteria | 1183 |
| 12 | Ga0070667_100194040 | 3300005367 | Bacteria | 1800 |
| 13 | Ga0070711_100258416 | 3300005439 | Bacteria | 1369 |
| 14 | Ga0070681_10100693 | 3300005458 | Bacteria | 2835 |
| 15 | Ga0070684_100083770 | 3300005535 | Bacteria | 2826 |
| 16 | Ga0068853_100254776 | 3300005539 | Bacteria | 1612 |
| 17 | Ga0070695_100010693 | 3300005545 | Bacteria | 5484 |
| 18 | Ga0070695_100089633 | 3300005545 | Bacteria | 2051 |
| 19 | Ga0070696_100093346 | 3300005546 | Bacteria | 2146 |
| 20 | Ga0070696_100211140 | 3300005546 | Bacteria | 1453 |
| 21 | Ga0070665_100080131 | 3300005548 | Bacteria | 3270 |
| 22 | Ga0068856_100224322 | 3300005614 | Bacteria | 1894 |
| 23 | Ga0068851_10194124 | 3300005834 | Bacteria | 1130 |
| 24 | Ga0068858_100749914 | 3300005842 | Bacteria | 951 |
| 25 | Ga0068862_100173966 | 3300005844 | Bacteria | 1929 |
| 26 | Ga0081538_10013198 | 3300005981 | Bacteria | 6557 |
| 27 | Ga0081539_10001341 | 3300005985 | Bacteria | 42889 |
| 28 | Ga0081539_10018606 | 3300005985 | Bacteria | 4810 |
| 29 | Ga0075365_10005444 | 3300006038 | Bacteria | 6865 |
| 30 | Ga0075368_10023389 | 3300006042 | Bacteria | 2360 |
| 31 | Ga0075363_100032372 | 3300006048 | Bacteria | 2715 |
| 32 | Ga0075363_100047483 | 3300006048 | Unclassified | 2280 |
| 33 | Ga0075364_10013696 | 3300006051 | Bacteria | 4994 |
| 34 | Ga0075367_10002266 | 3300006178 | Bacteria | 8713 |
| 35 | Ga0075367_10004456 | 3300006178 | Bacteria | 6842 |
| 36 | Ga0075367_10050888 | 3300006178 | Bacteria | 2447 |
| 37 | Ga0075367_10126345 | 3300006178 | Bacteria | 1578 |
| 38 | Ga0075428_100259712 | 3300006844 | Bacteria | 1870 |
| 39 | Ga0075433_10029672 | 3300006852 | Bacteria | 4662 |
| 40 | Ga0075433_10114377 | 3300006852 | Bacteria | 2394 |
| 41 | Ga0075434_100015591 | 3300006871 | Bacteria | 7294 |
| 42 | Ga0075435_100037938 | 3300007076 | Bacteria | 3840 |
| 43 | Ga0099794_10003053 | 3300007265 | Bacteria | 6322 |
| 44 | Ga0111539_10595758 | 3300009094 | Bacteria | 1287 |
| 45 | Ga0105247_10064820 | 3300009101 | Bacteria | 2271 |
| 46 | Ga0114129_10001230 | 3300009147 | Bacteria | 34074 |
| 47 | Ga0105243_10339087 | 3300009148 | Bacteria | 1376 |
| 48 | Ga0105237_10117297 | 3300009545 | Bacteria | 2656 |
| 49 | Ga0105238_10011620 | 3300009551 | Bacteria | 8869 |
| 50 | Ga0105249_10008747 | 3300009553 | Bacteria | 8834 |
| 51 | Ga0099796_10038685 | 3300010159 | Bacteria | 1602 |
| 52 | Ga0105239_10247247 | 3300010375 | Bacteria | 2003 |
| 53 | Ga0157378_10522212 | 3300013297 | Bacteria | 1189 |
| 54 | Ga0163163_10293696 | 3300014325 | Bacteria | 1677 |
| 55 | Ga0157380_10023957 | 3300014326 | Bacteria | 4613 |
| 56 | Ga0157377_10037674 | 3300014745 | Bacteria | 2665 |
| 57 | Ga0213876_10046011 | 3300021384 | Bacteria | 2307 |
| 58 | Ga0209563_103532 | 3300025230 | Bacteria | 3204 |
| 59 | Ga0209758_1000651 | 3300025297 | Bacteria | 52531 |
| 60 | Ga0207710_10231057 | 3300025900 | Bacteria | 920 |
| 61 | Ga0207660_10241047 | 3300025917 | Bacteria | 1424 |
| 62 | Ga0207694_10166984 | 3300025924 | Bacteria | 1780 |
| 63 | Ga0207712_10009793 | 3300025961 | Bacteria | 6073 |
| 64 | Ga0207668_10081416 | 3300025972 | Bacteria | 2349 |
| 65 | Ga0207658_10249648 | 3300025986 | Unclassified | 1507 |
| 66 | Ga0207677_10474858 | 3300026023 | Bacteria | 1076 |
| 67 | Ga0207708_10301732 | 3300026075 | Unclassified | 1303 |
| 68 | Ga0207641_10087212 | 3300026088 | Bacteria | 2723 |
| 69 | Ga0207676_10392712 | 3300026095 | Bacteria | 1294 |
| 70 | Ga0207675_100036917 | 3300026118 | Bacteria | 4558 |
| 71 | Ga0207675_100135393 | 3300026118 | Bacteria | 2337 |
| 72 | Ga0209998_10015691 | 3300027717 | Bacteria | 1589 |
| 73 | Ga0209974_10099684 | 3300027876 | Unclassified | 1014 |
| 74 | Ga0207428_10044480 | 3300027907 | Bacteria | 3582 |
| 75 | Ga0268265_10091713 | 3300028380 | Bacteria | 2430 |
| 76 | Ga0268264_10403930 | 3300028381 | Bacteria | 1313 |
| 77 | Ga0307517_10165026 | 3300028786 | Bacteria | 1474 |
| 78 | Ga0307408_100497562 | 3300031548 | Bacteria | 1066 |
| 79 | Ga0307405_10567820 | 3300031731 | Bacteria | 921 |
| 80 | Ga0307409_100838939 | 3300031995 | Bacteria | 929 |
| 81 | Ga0373958_0006578 | 3300034819 | Bacteria | 1817 |
| 82 | Ga0373928_0003840 | 3300035084 | Bacteria | 2864 |
| 83 | Ga0373940_0013145 | 3300035088 | Bacteria | 1996 |
| 84 | Ga0373932_0004338 | 3300035112 | Bacteria | 3362 |
| 85 | Ga0373939_0001038 | 3300035114 | Bacteria | 6849 |
| 86 | Ga0373939_0010230 | 3300035114 | Bacteria | 2340 |
| 87 | Ga0373960_0036217 | 3300035121 | Bacteria | 1404 |
| 88 | Ga0373943_0042850 | 3300035170 | Bacteria | 2195 |
| 89 | Ga0373961_0010787 | 3300035241 | Bacteria | 2258 |
| 90 | Ga0373961_0067222 | 3300035241 | Bacteria | 1101 |
| 91 | Ga0373962_0002568 | 3300035242 | Bacteria | 4309 |
| 92 | Ga0373931_0003765 | 3300035691 | Bacteria | 6858 |
| 93 | Ga0373927_0049706 | 3300035695 | Bacteria | 2711 |
| 94 | Ga0373937_0268906 | 3300036401 | Bacteria | 1609 |
| 95 | Ga0373925_0178620 | 3300037068 | Bacteria | 1679 |
| 96 | Ga0395898_0480461 | 3300037466 | Bacteria | 1182 |
| 97 | Ga0436364_0076977 | 3300037853 | Bacteria | 1366 |
| 98 | Ga0436365_0222218 | 3300039437 | Bacteria | 8871 |
| 99 | Ga0436360_0327032 | 3300039438 | Bacteria | 2200 |
| 100 | Ga0436363_0852909 | 3300039450 | Bacteria | 3610 |
| 101 | Ga0436362_0518132 | 3300039453 | Bacteria | 1249 |
| 102 | Ga0453683_0159359 | 3300044673 | Bacteria | 1428 |
| 103 | Ga0466963_0057293 | 3300044694 | Bacteria | 2595 |
| 104 | Ga0466967_0941207 | 3300045976 | Bacteria | 860 |
| 105 | Ga0495603_0050113 | 3300046455 | Bacteria | 2484 |
| 106 | Ga0495603_0115827 | 3300046455 | Bacteria | 1563 |
| 107 | Ga0495629_0083192 | 3300046459 | Bacteria | 2234 |
| 108 | Ga0495594_0129156 | 3300046499 | Bacteria | 1431 |
| 109 | Ga0495672_0240415 | 3300047320 | Bacteria | 884 |
| 110 | Ga0495686_0087366 | 3300047472 | Bacteria | 1896 |
| 111 | Ga0496104_0006466 | 3300048907 | Bacteria | 10301 |
| 112 | Ga0496104_0031953 | 3300048907 | Bacteria | 4898 |
| 113 | Ga0496105_0006116 | 3300048908 | Bacteria | 9216 |
| 114 | Ga0496105_0048106 | 3300048908 | Bacteria | 3520 |
| 115 | Ga0496106_0115254 | 3300048909 | Bacteria | 2095 |
| 116 | Ga0496108_0005523 | 3300048911 | Bacteria | 10227 |
| 117 | Ga0496108_0365575 | 3300048911 | Bacteria | 1259 |
| 118 | Ga0496109_0039106 | 3300048912 | Bacteria | 4292 |
| 119 | Ga0496109_0226916 | 3300048912 | Bacteria | 1757 |
| 120 | Ga0496110_0023893 | 3300048913 | Bacteria | 5204 |
| 121 | Ga0496111_0061755 | 3300048914 | Unclassified | 2716 |
| 122 | Ga0496112_0008371 | 3300048915 | Bacteria | 9263 |
| 123 | Ga0496112_0010540 | 3300048915 | Bacteria | 8392 |
| 124 | Ga0496112_0077516 | 3300048915 | Bacteria | 3287 |
| 125 | Ga0496112_0451055 | 3300048915 | Bacteria | 1224 |
| 126 | Ga0496113_0002592 | 3300048916 | Bacteria | 10561 |
| 127 | Ga0496115_0113624 | 3300048918 | Bacteria | 2225 |
| 128 | Ga0496125_0007638 | 3300048928 | Bacteria | 11467 |
| 129 | Ga0496126_0070615 | 3300048929 | Bacteria | 3111 |
| 130 | Ga0496126_0078323 | 3300048929 | Bacteria | 2929 |
| 131 | nmdc:mga03n38_12053_c1 | 3300050490 | Bacteria | 3242 |
| 132 | nmdc:mga00v17_663_c1 | 3300050491 | Bacteria | 18944 |
| 133 | nmdc:mga0yw44_131360_c1 | 3300050492 | Bacteria | 1621 |
| 134 | nmdc:mga06z11_1221_c1 | 3300050494 | Bacteria | 9490 |
| 135 | nmdc:mga06z11_122665_c1 | 3300050494 | Bacteria | 1451 |
| 136 | nmdc:mga06z11_21602_c1 | 3300050494 | Bacteria | 2994 |
| 137 | nmdc:mga06z11_24353_c1 | 3300050494 | Bacteria | 2855 |
| 138 | nmdc:mga06z11_374_c1 | 3300050494 | Bacteria | 16845 |
| 139 | nmdc:mga04h51_183353_c1 | 3300050495 | Bacteria | 816 |
| 140 | nmdc:mga04h51_24007_c1 | 3300050495 | Bacteria | 1863 |
| 141 | nmdc:mga07m45_27672_c1 | 3300050496 | Bacteria | 3125 |
| 142 | nmdc:mga05p37_938_c1 | 3300050507 | Bacteria | 32835 |
| 143 | nmdc:mga08y16_19131_c1 | 3300050511 | Bacteria | 7216 |
| 144 | nmdc:mga0n895_11553_c1 | 3300050512 | Bacteria | 7887 |
| 145 | nmdc:mga0n895_91521_c1 | 3300050512 | Bacteria | 3044 |
| 146 | nmdc:mga0rr50_356475_c1 | 3300050513 | Bacteria | 1231 |
| 147 | nmdc:mga0rr50_6215_c1 | 3300050513 | Bacteria | 7239 |
| 148 | nmdc:mga0a205_604751_c1 | 3300050515 | Bacteria | 949 |
| 149 | nmdc:mga0a205_64981_c1 | 3300050515 | Bacteria | 3525 |
| 150 | Ga0500641_0007425 | 3300053096 | Bacteria | 3909 |
| 151 | Ga0500568_0104552 | 3300053139 | Bacteria | 1061 |
| 152 | Ga0500616_0033263 | 3300053153 | Bacteria | 2813 |
| 153 | Ga0500638_023142 | 3300053162 | Bacteria | 2950 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046499 | Ga0495594_0129156 | Ga0495594_0129156_10_687 | 225 |
| 2 | 3300007265 | Ga0099794_10003053 | Ga0099794_100030534 | 227 |
| 3 | 3300053096 | Ga0500641_0007425 | Ga0500641_0007425_92_835 | 230 |
| 4 | 3300046455 | Ga0495603_0050113 | Ga0495603_0050113_1776_2474 | 232 |
| 5 | 3300046455 | Ga0495603_0115827 | Ga0495603_0115827_30_728 | 232 |
| 6 | 3300050515 | nmdc:mga0a205_604751_c1 | nmdc:mga0a205_604751_c1_88_792 | 232 |
| 7 | 3300006852 | Ga0075433_10029672 | Ga0075433_100296727 | 234 |
| 8 | 3300006871 | Ga0075434_100015591 | Ga0075434_10001559110 | 234 |
| 9 | 3300007076 | Ga0075435_100037938 | Ga0075435_1000379382 | 234 |
| 10 | 3300009147 | Ga0114129_10001230 | Ga0114129_1000123014 | 234 |
| 11 | 3300050507 | nmdc:mga05p37_938_c1 | nmdc:mga05p37_938_c1_8810_9586 | 234 |
| 12 | 3300050512 | nmdc:mga0n895_11553_c1 | nmdc:mga0n895_11553_c1_1611_2387 | 234 |
| 13 | 3300050513 | nmdc:mga0rr50_6215_c1 | nmdc:mga0rr50_6215_c1_1614_2390 | 234 |
| 14 | 3300050515 | nmdc:mga0a205_64981_c1 | nmdc:mga0a205_64981_c1_2035_2811 | 234 |
| 15 | 3300005548 | Ga0070665_100080131 | Ga0070665_1000801312 | 236 |
| 16 | 3300010159 | Ga0099796_10038685 | Ga0099796_100386851 | 236 |
| 17 | 3300021384 | Ga0213876_10046011 | Ga0213876_100460112 | 236 |
| 18 | 3300039437 | Ga0436365_0222218 | Ga0436365_0222218_2463_3218 | 236 |
| 19 | 3300005535 | Ga0070684_100083770 | Ga0070684_1000837702 | 237 |
| 20 | 3300005545 | Ga0070695_100089633 | Ga0070695_1000896333 | 237 |
| 21 | 3300005842 | Ga0068858_100749914 | Ga0068858_1007499141 | 237 |
| 22 | 3300009545 | Ga0105237_10117297 | Ga0105237_101172973 | 237 |
| 23 | 3300009551 | Ga0105238_10011620 | Ga0105238_100116204 | 237 |
| 24 | 3300025924 | Ga0207694_10166984 | Ga0207694_101669842 | 237 |
| 25 | 3300037853 | Ga0436364_0076977 | Ga0436364_0076977_525_1274 | 237 |
| 26 | 3300039453 | Ga0436362_0518132 | Ga0436362_0518132_115_864 | 237 |
| 27 | 3300035170 | Ga0373943_0042850 | Ga0373943_0042850_427_1179 | 238 |
| 28 | 3300035695 | Ga0373927_0049706 | Ga0373927_0049706_499_1251 | 238 |
| 29 | 3300037068 | Ga0373925_0178620 | Ga0373925_0178620_910_1662 | 238 |
| 30 | 3300005614 | Ga0068856_100224322 | Ga0068856_1002243222 | 244 |
| 31 | 3300044694 | Ga0466963_0057293 | Ga0466963_0057293_868_1617 | 244 |
| 32 | iso_pu_bacteria | 2894772417 | 2894772888 | 244 |
| 33 | iso_pu_bacteria | 8045864390 | 8045866720 | 244 |
| 34 | iso_pu_bacteria | 2643221736 | 2644743139 | 245 |
| 35 | iso_pu_bacteria | 2841760612 | 2841761133 | 245 |
| 36 | iso_pu_bacteria | 2844104063 | 2844104158 | 245 |
| 37 | iso_pu_bacteria | 2851182111 | 2851184141 | 245 |
| 38 | iso_pu_bacteria | 2851246043 | 2851247146 | 245 |
| 39 | iso_pu_bacteria | 2888388044 | 2888388276 | 245 |
| 40 | 3300003203 | JGI25406J46586_10012721 | JGI25406J46586_100127213 | 246 |
| 41 | 3300005985 | Ga0081539_10001341 | Ga0081539_1000134124 | 246 |
| 42 | 3300048915 | Ga0496112_0451055 | Ga0496112_0451055_38_784 | 246 |
| 43 | 3300003203 | JGI25406J46586_10001533 | JGI25406J46586_100015335 | 247 |
| 44 | 3300003323 | rootH1_10202244 | rootH1_102022443 | 247 |
| 45 | 3300005293 | Ga0065715_10101597 | Ga0065715_101015973 | 247 |
| 46 | 3300005334 | Ga0068869_100035251 | Ga0068869_1000352514 | 247 |
| 47 | 3300005335 | Ga0070666_10356165 | Ga0070666_103561651 | 247 |
| 48 | 3300005338 | Ga0068868_100678938 | Ga0068868_1006789381 | 247 |
| 49 | 3300005347 | Ga0070668_100024703 | Ga0070668_1000247034 | 247 |
| 50 | 3300005347 | Ga0070668_100059920 | Ga0070668_1000599202 | 247 |
| 51 | 3300005347 | Ga0070668_100662798 | Ga0070668_1006627982 | 247 |
| 52 | 3300005354 | Ga0070675_100428826 | Ga0070675_1004288262 | 247 |
| 53 | 3300005367 | Ga0070667_100194040 | Ga0070667_1001940402 | 247 |
| 54 | 3300005439 | Ga0070711_100258416 | Ga0070711_1002584162 | 247 |
| 55 | 3300005458 | Ga0070681_10100693 | Ga0070681_101006932 | 247 |
| 56 | 3300005539 | Ga0068853_100254776 | Ga0068853_1002547762 | 247 |
| 57 | 3300005545 | Ga0070695_100010693 | Ga0070695_1000106932 | 247 |
| 58 | 3300005546 | Ga0070696_100093346 | Ga0070696_1000933463 | 247 |
| 59 | 3300005546 | Ga0070696_100211140 | Ga0070696_1002111401 | 247 |
| 60 | 3300005834 | Ga0068851_10194124 | Ga0068851_101941243 | 247 |
| 61 | 3300005844 | Ga0068862_100173966 | Ga0068862_1001739662 | 247 |
| 62 | 3300005981 | Ga0081538_10013198 | Ga0081538_100131982 | 247 |
| 63 | 3300005985 | Ga0081539_10018606 | Ga0081539_100186063 | 247 |
| 64 | 3300006038 | Ga0075365_10005444 | Ga0075365_100054445 | 247 |
| 65 | 3300006042 | Ga0075368_10023389 | Ga0075368_100233891 | 247 |
| 66 | 3300006048 | Ga0075363_100032372 | Ga0075363_1000323722 | 247 |
| 67 | 3300006048 | Ga0075363_100047483 | Ga0075363_1000474832 | 247 |
| 68 | 3300006051 | Ga0075364_10013696 | Ga0075364_100136964 | 247 |
| 69 | 3300006178 | Ga0075367_10002266 | Ga0075367_100022669 | 247 |
| 70 | 3300006178 | Ga0075367_10004456 | Ga0075367_100044564 | 247 |
| 71 | 3300006178 | Ga0075367_10050888 | Ga0075367_100508883 | 247 |
| 72 | 3300006178 | Ga0075367_10126345 | Ga0075367_101263452 | 247 |
| 73 | 3300006844 | Ga0075428_100259712 | Ga0075428_1002597123 | 247 |
| 74 | 3300006852 | Ga0075433_10114377 | Ga0075433_101143771 | 247 |
| 75 | 3300009094 | Ga0111539_10595758 | Ga0111539_105957582 | 247 |
| 76 | 3300009101 | Ga0105247_10064820 | Ga0105247_100648202 | 247 |
| 77 | 3300009148 | Ga0105243_10339087 | Ga0105243_103390872 | 247 |
| 78 | 3300009553 | Ga0105249_10008747 | Ga0105249_100087475 | 247 |
| 79 | 3300010375 | Ga0105239_10247247 | Ga0105239_102472471 | 247 |
| 80 | 3300013297 | Ga0157378_10522212 | Ga0157378_105222121 | 247 |
| 81 | 3300014325 | Ga0163163_10293696 | Ga0163163_102936961 | 247 |
| 82 | 3300014326 | Ga0157380_10023957 | Ga0157380_100239573 | 247 |
| 83 | 3300014745 | Ga0157377_10037674 | Ga0157377_100376741 | 247 |
| 84 | 3300025230 | Ga0209563_103532 | Ga0209563_1035322 | 247 |
| 85 | 3300025297 | Ga0209758_1000651 | Ga0209758_100065147 | 247 |
| 86 | 3300025900 | Ga0207710_10231057 | Ga0207710_102310571 | 247 |
| 87 | 3300025917 | Ga0207660_10241047 | Ga0207660_102410472 | 247 |
| 88 | 3300025961 | Ga0207712_10009793 | Ga0207712_100097933 | 247 |
| 89 | 3300025972 | Ga0207668_10081416 | Ga0207668_100814163 | 247 |
| 90 | 3300025986 | Ga0207658_10249648 | Ga0207658_102496482 | 247 |
| 91 | 3300026023 | Ga0207677_10474858 | Ga0207677_104748582 | 247 |
| 92 | 3300026075 | Ga0207708_10301732 | Ga0207708_103017322 | 247 |
| 93 | 3300026088 | Ga0207641_10087212 | Ga0207641_100872122 | 247 |
| 94 | 3300026095 | Ga0207676_10392712 | Ga0207676_103927122 | 247 |
| 95 | 3300026118 | Ga0207675_100036917 | Ga0207675_1000369175 | 247 |
| 96 | 3300026118 | Ga0207675_100135393 | Ga0207675_1001353933 | 247 |
| 97 | 3300027717 | Ga0209998_10015691 | Ga0209998_100156912 | 247 |
| 98 | 3300027876 | Ga0209974_10099684 | Ga0209974_100996842 | 247 |
| 99 | 3300027907 | Ga0207428_10044480 | Ga0207428_100444802 | 247 |
| 100 | 3300028380 | Ga0268265_10091713 | Ga0268265_100917132 | 247 |
| 101 | 3300028381 | Ga0268264_10403930 | Ga0268264_104039302 | 247 |
| 102 | 3300028786 | Ga0307517_10165026 | Ga0307517_101650262 | 247 |
| 103 | 3300031548 | Ga0307408_100497562 | Ga0307408_1004975621 | 247 |
| 104 | 3300031731 | Ga0307405_10567820 | Ga0307405_105678201 | 247 |
| 105 | 3300031995 | Ga0307409_100838939 | Ga0307409_1008389391 | 247 |
| 106 | 3300034819 | Ga0373958_0006578 | Ga0373958_0006578_174_926 | 247 |
| 107 | 3300035084 | Ga0373928_0003840 | Ga0373928_0003840_1934_2686 | 247 |
| 108 | 3300035088 | Ga0373940_0013145 | Ga0373940_0013145_258_1010 | 247 |
| 109 | 3300035112 | Ga0373932_0004338 | Ga0373932_0004338_1987_2739 | 247 |
| 110 | 3300035114 | Ga0373939_0001038 | Ga0373939_0001038_1185_1937 | 247 |
| 111 | 3300035114 | Ga0373939_0010230 | Ga0373939_0010230_504_1256 | 247 |
| 112 | 3300035121 | Ga0373960_0036217 | Ga0373960_0036217_491_1243 | 247 |
| 113 | 3300035241 | Ga0373961_0010787 | Ga0373961_0010787_1215_1967 | 247 |
| 114 | 3300035241 | Ga0373961_0067222 | Ga0373961_0067222_321_1073 | 247 |
| 115 | 3300035242 | Ga0373962_0002568 | Ga0373962_0002568_3448_4200 | 247 |
| 116 | 3300035691 | Ga0373931_0003765 | Ga0373931_0003765_4281_5033 | 247 |
| 117 | 3300036401 | Ga0373937_0268906 | Ga0373937_0268906_822_1574 | 247 |
| 118 | 3300037466 | Ga0395898_0480461 | Ga0395898_0480461_412_1155 | 247 |
| 119 | 3300039438 | Ga0436360_0327032 | Ga0436360_0327032_112_903 | 247 |
| 120 | 3300039450 | Ga0436363_0852909 | Ga0436363_0852909_33_776 | 247 |
| 121 | 3300044673 | Ga0453683_0159359 | Ga0453683_0159359_195_947 | 247 |
| 122 | 3300045976 | Ga0466967_0941207 | Ga0466967_0941207_87_845 | 247 |
| 123 | 3300046459 | Ga0495629_0083192 | Ga0495629_0083192_766_1509 | 247 |
| 124 | 3300047320 | Ga0495672_0240415 | Ga0495672_0240415_52_807 | 247 |
| 125 | 3300047472 | Ga0495686_0087366 | Ga0495686_0087366_814_1557 | 247 |
| 126 | 3300048907 | Ga0496104_0006466 | Ga0496104_0006466_1711_2460 | 247 |
| 127 | 3300048907 | Ga0496104_0031953 | Ga0496104_0031953_181_936 | 247 |
| 128 | 3300048908 | Ga0496105_0006116 | Ga0496105_0006116_7263_8012 | 247 |
| 129 | 3300048908 | Ga0496105_0048106 | Ga0496105_0048106_409_1164 | 247 |
| 130 | 3300048909 | Ga0496106_0115254 | Ga0496106_0115254_772_1527 | 247 |
| 131 | 3300048911 | Ga0496108_0005523 | Ga0496108_0005523_1944_2693 | 247 |
| 132 | 3300048911 | Ga0496108_0365575 | Ga0496108_0365575_19_774 | 247 |
| 133 | 3300048912 | Ga0496109_0039106 | Ga0496109_0039106_1735_2484 | 247 |
| 134 | 3300048912 | Ga0496109_0226916 | Ga0496109_0226916_203_958 | 247 |
| 135 | 3300048913 | Ga0496110_0023893 | Ga0496110_0023893_4156_4905 | 247 |
| 136 | 3300048914 | Ga0496111_0061755 | Ga0496111_0061755_1778_2527 | 247 |
| 137 | 3300048915 | Ga0496112_0008371 | Ga0496112_0008371_3695_4450 | 247 |
| 138 | 3300048915 | Ga0496112_0010540 | Ga0496112_0010540_5052_5801 | 247 |
| 139 | 3300048915 | Ga0496112_0077516 | Ga0496112_0077516_1107_1850 | 247 |
| 140 | 3300048916 | Ga0496113_0002592 | Ga0496113_0002592_2405_3154 | 247 |
| 141 | 3300048918 | Ga0496115_0113624 | Ga0496115_0113624_14_769 | 247 |
| 142 | 3300048928 | Ga0496125_0007638 | Ga0496125_0007638_10235_10984 | 247 |
| 143 | 3300048929 | Ga0496126_0070615 | Ga0496126_0070615_2321_3070 | 247 |
| 144 | 3300048929 | Ga0496126_0078323 | Ga0496126_0078323_11_802 | 247 |
| 145 | 3300050490 | nmdc:mga03n38_12053_c1 | nmdc:mga03n38_12053_c1_1328_2077 | 247 |
| 146 | 3300050491 | nmdc:mga00v17_663_c1 | nmdc:mga00v17_663_c1_12704_13453 | 247 |
| 147 | 3300050492 | nmdc:mga0yw44_131360_c1 | nmdc:mga0yw44_131360_c1_405_1154 | 247 |
| 148 | 3300050494 | nmdc:mga06z11_1221_c1 | nmdc:mga06z11_1221_c1_4802_5551 | 247 |
| 149 | 3300050494 | nmdc:mga06z11_122665_c1 | nmdc:mga06z11_122665_c1_431_1186 | 247 |
| 150 | 3300050494 | nmdc:mga06z11_21602_c1 | nmdc:mga06z11_21602_c1_1520_2269 | 247 |
| 151 | 3300050494 | nmdc:mga06z11_24353_c1 | nmdc:mga06z11_24353_c1_1499_2248 | 247 |
| 152 | 3300050494 | nmdc:mga06z11_374_c1 | nmdc:mga06z11_374_c1_13506_14348 | 247 |
| 153 | 3300050495 | nmdc:mga04h51_183353_c1 | nmdc:mga04h51_183353_c1_23_772 | 247 |
| 154 | 3300050495 | nmdc:mga04h51_24007_c1 | nmdc:mga04h51_24007_c1_55_804 | 247 |
| 155 | 3300050496 | nmdc:mga07m45_27672_c1 | nmdc:mga07m45_27672_c1_1783_2625 | 247 |
| 156 | 3300050511 | nmdc:mga08y16_19131_c1 | nmdc:mga08y16_19131_c1_215_970 | 247 |
| 157 | 3300050512 | nmdc:mga0n895_91521_c1 | nmdc:mga0n895_91521_c1_1934_2686 | 247 |
| 158 | 3300050513 | nmdc:mga0rr50_356475_c1 | nmdc:mga0rr50_356475_c1_413_1165 | 247 |
| 159 | 3300053139 | Ga0500568_0104552 | Ga0500568_0104552_135_890 | 247 |
| 160 | 3300053153 | Ga0500616_0033263 | Ga0500616_0033263_1090_1836 | 247 |
| 161 | 3300053162 | Ga0500638_023142 | Ga0500638_023142_1643_2446 | 247 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6l8p-assembly1.cif.gz_B | crystal structure of rida from antarctic bacterium psychrobacter sp. pamc 21119 | 0.7701 | 135 | 242 |
| 2dyy-assembly4.cif.gz_J | crystal structure of putative translation initiation inhibitor ph0854 from pyrococcus horikoshii | 0.7474 | 135 | 243 |
| 2dyy-assembly2.cif.gz_E | crystal structure of putative translation initiation inhibitor ph0854 from pyrococcus horikoshii | 0.7473 | 135 | 241 |
| 2b33-assembly1.cif.gz_A | crystal structure of a putative endoribonuclease (tm0215) from thermotoga maritima msb8 at 2.30 a resolution | 0.746 | 135 | 243 |
| 1xrg-assembly1.cif.gz_A | conserved hypothetical protein from clostridium thermocellum cth-2968 | 0.7422 | 135 | 241 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3k0tB00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.742 | 135 | 242 | 3.30.1330.40 |
| af_A0A1D8PGY1_281_387_3.30.1330.40 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.7419 | 43 | 127 | 3.30.1330.40 |
| 3gtzB00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.7397 | 135 | 242 | 3.30.1330.40 |
| 1nq3C00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.7383 | 135 | 241 | 3.30.1330.40 |
| 2dyyG00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.7263 | 135 | 243 | 3.30.1330.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A533J4E5-F1-model_v4 | deleted | 1 | 1 | 247 |
|
| AF-A0A4Q4K555-F1-model_v4 | deleted | 0.9987 | 1 | 247 |
|
| AF-A0A537ULS4-F1-model_v4 | Uncharacterized protein | 0.9973 | 1 | 247 |
|
| AF-A0A6G8ZGT3-F1-model_v4 | deleted | 0.997 | 1 | 247 |
|
| AF-A0A4Q5PP68-F1-model_v4 | RidA family protein | 0.9964 | 1 | 247 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar