F237602

General Info

Members Datasets Scaffolds Average Seq Length
161 113 322 297

Family's Representative Sequence

Representative Sequence 3300044901|Ga0466960_0083096|Ga0466960_0083096_673_1554
Length 275
Sequence MPTAATIEGVTHHRAAVNGTELHYVAAGAAGSPVLLVHGFPESWWVFHRLIPLLAARHRVVAVDLRGFGDSAVAGADHGPVHLTGQDVSGPTTYRLAATHPELVRSFTAIETGLPGFGLEQLADVTHGGAWHIGVLAAPGIPELLLAGRERAFLKDYAIPSLTATADAFGDADLDELARGYARDGGFRGAAGLYRSLLAEGPEIRELAARPPAMPVLAVGGGSGDFTAAALRQVAPDVRTTTFDGVGHYVAMEAPERLAAELLAFFGDADGRAAG

Samples

Sample ID Description Type Environment
1 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
15 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
16 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
17 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
20 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
21 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
22 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
23 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
24 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
25 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
26 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
27 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
36 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
37 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
38 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
39 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
40 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
41 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
42 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
43 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
44 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
45 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
46 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
47 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
48 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
49 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
50 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
51 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
52 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
53 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
54 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
55 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
56 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
57 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
58 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
59 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
60 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
61 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
62 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
63 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
64 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
65 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
66 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
67 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
68 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
69 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
70 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
71 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
72 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
73 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
74 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
75 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
76 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
77 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
78 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
79 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
80 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
81 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
82 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
83 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
84 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
85 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
86 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
87 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
88 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
89 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
98 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
99 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
100 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
101 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
102 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
103 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
104 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
105 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
106 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
107 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
108 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
109 2808606372 Agromyces sp. 23-23 Isolate Unclassified
110 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
111 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
112 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
113 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.27
Metatranscriptomes 0
Isolates 3.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.21
Nodule 0
Rhizoplane 3.11
Rhizosphere 80.12
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466960_0083096 3300044901 Bacteria 1618
2 JGI25406J46586_10001631 3300003203 Bacteria 10583
3 JGI25407J50210_10010661 3300003373 Bacteria 2341
4 Ga0070667_100173826 3300005367 Bacteria 1903
5 Ga0070709_10062025 3300005434 Bacteria 2382
6 Ga0070709_10254965 3300005434 Bacteria 1265
7 Ga0070714_100019251 3300005435 Bacteria 5555
8 Ga0070714_100095387 3300005435 Bacteria 2612
9 Ga0070714_100161377 3300005435 Bacteria 2028
10 Ga0070714_100550944 3300005435 Bacteria 1104
11 Ga0070713_100099066 3300005436 Bacteria 2521
12 Ga0070713_100157914 3300005436 Bacteria 2022
13 Ga0070713_100171201 3300005436 Bacteria 1945
14 Ga0070713_100362363 3300005436 Bacteria 1347
15 Ga0070710_10066599 3300005437 Bacteria 2065
16 Ga0070710_10068974 3300005437 Bacteria 2033
17 Ga0070711_100138981 3300005439 Bacteria 1819
18 Ga0070711_100176996 3300005439 Bacteria 1630
19 Ga0070708_100108654 3300005445 Bacteria 2548
20 Ga0070707_100058295 3300005468 Bacteria 3704
21 Ga0070698_100003958 3300005471 Bacteria 16291
22 Ga0070699_100136522 3300005518 Bacteria 2164
23 Ga0068861_100209771 3300005719 Bacteria 1640
24 Ga0081538_10001847 3300005981 Bacteria 21356
25 Ga0081538_10016959 3300005981 Bacteria 5556
26 Ga0081540_1022724 3300005983 Bacteria 3696
27 Ga0081540_1070814 3300005983 Bacteria 1613
28 Ga0081539_10001458 3300005985 Bacteria 40256
29 Ga0070717_10248929 3300006028 Bacteria 1569
30 Ga0070716_100057770 3300006173 Bacteria 2230
31 Ga0070712_100035775 3300006175 Bacteria 3373
32 Ga0105243_10292800 3300009148 Bacteria 1472
33 Ga0105237_10441368 3300009545 Bacteria 1307
34 Ga0105249_10771942 3300009553 Bacteria 1024
35 Ga0105239_10112487 3300010375 Bacteria 3019
36 Ga0157376_10294952 3300014969 Bacteria 1532
37 Ga0213875_10001206 3300021388 Bacteria 17611
38 Ga0207692_10029564 3300025898 Bacteria 2606
39 Ga0207692_10218679 3300025898 Bacteria 1128
40 Ga0207699_10078187 3300025906 Bacteria 2043
41 Ga0207699_10153880 3300025906 Bacteria 1524
42 Ga0207699_10174843 3300025906 Bacteria 1439
43 Ga0207693_10042263 3300025915 Bacteria 3588
44 Ga0207663_10219987 3300025916 Bacteria 1381
45 Ga0207663_10270568 3300025916 Bacteria 1258
46 Ga0207646_10051055 3300025922 Bacteria 3701
47 Ga0207700_10280608 3300025928 Bacteria 1433
48 Ga0207700_10298901 3300025928 Bacteria 1389
49 Ga0207664_10108252 3300025929 Bacteria 2307
50 Ga0207698_10542366 3300026142 Bacteria 1139
51 Ga0265334_10029712 3300028573 Bacteria 2190
52 Ga0265318_10000774 3300028577 Bacteria 21210
53 Ga0265318_10001889 3300028577 Bacteria 11749
54 Ga0307515_10006821 3300028794 Bacteria 22715
55 Ga0265338_10004551 3300028800 Bacteria 18666
56 Ga0265338_10007407 3300028800 Bacteria 13632
57 Ga0265338_10028923 3300028800 Bacteria 5513
58 Ga0307512_10002634 3300030522 Bacteria 22212
59 Ga0307512_10010048 3300030522 Bacteria 9061
60 Ga0307512_10011882 3300030522 Bacteria 8230
61 Ga0265330_10000484 3300031235 Bacteria 26678
62 Ga0265330_10007876 3300031235 Bacteria 5163
63 Ga0265330_10051125 3300031235 Bacteria 1812
64 Ga0265332_10000504 3300031238 Bacteria 26693
65 Ga0265320_10000587 3300031240 Bacteria 27982
66 Ga0265320_10132207 3300031240 Bacteria 1133
67 Ga0265325_10009127 3300031241 Bacteria 5808
68 Ga0265329_10001304 3300031242 Bacteria 12116
69 Ga0265340_10003114 3300031247 Bacteria 9405
70 Ga0265340_10019199 3300031247 Bacteria 3520
71 Ga0265340_10041993 3300031247 Bacteria 2246
72 Ga0265340_10049679 3300031247 Bacteria 2037
73 Ga0265339_10005188 3300031249 Bacteria 8727
74 Ga0265339_10029546 3300031249 Bacteria 3110
75 Ga0265331_10001185 3300031250 Bacteria 19739
76 Ga0265327_10051376 3300031251 Bacteria 2152
77 Ga0265316_10003999 3300031344 Bacteria 14759
78 Ga0265316_10018463 3300031344 Bacteria 5992
79 Ga0307513_10021867 3300031456 Bacteria 7537
80 Ga0265313_10000078 3300031595 Bacteria 95571
81 Ga0265313_10000196 3300031595 Bacteria 64798
82 Ga0265313_10005456 3300031595 Bacteria 9352
83 Ga0265313_10022226 3300031595 Bacteria 3447
84 Ga0265313_10058720 3300031595 Bacteria 1812
85 Ga0307508_10101199 3300031616 Bacteria 2477
86 Ga0307508_10227299 3300031616 Bacteria 1465
87 Ga0265314_10000967 3300031711 Bacteria 33769
88 Ga0265314_10003197 3300031711 Bacteria 16041
89 Ga0265314_10012072 3300031711 Bacteria 7080
90 Ga0265314_10044428 3300031711 Bacteria 3150
91 Ga0265342_10000690 3300031712 Bacteria 35337
92 Ga0265342_10186402 3300031712 Bacteria 1134
93 Ga0307410_10028739 3300031852 Bacteria 3532
94 Ga0307507_10159929 3300033179 Bacteria 1667
95 Ga0373951_0000017 3300035091 Bacteria 65961
96 Ga0436364_0746122 3300037853 Bacteria 46079
97 Ga0451789_0485963 3300041443 Bacteria 1862
98 Ga0451793_1148868 3300041452 Bacteria 1099
99 Ga0451793_1278335 3300041452 Bacteria 1252
100 Ga0451802_0426543 3300041460 Bacteria 1839
101 Ga0466961_0022154 3300044693 Bacteria 4088
102 Ga0495592_0033725 3300046454 Bacteria 3860
103 Ga0495592_0129670 3300046454 Bacteria 1765
104 Ga0495651_0027134 3300046462 Bacteria 4460
105 Ga0495651_0047268 3300046462 Bacteria 3328
106 Ga0495653_0208766 3300046463 Bacteria 1320
107 Ga0495664_0036151 3300046477 Bacteria 2910
108 Ga0495594_0041620 3300046499 Bacteria 2515
109 Ga0495628_0078833 3300046516 Bacteria 2561
110 Ga0495628_0116077 3300046516 Bacteria 2056
111 Ga0495630_0045193 3300046517 Bacteria 3290
112 Ga0495666_0001104 3300046526 Bacteria 12896
113 Ga0495652_0004335 3300046529 Bacteria 13589
114 Ga0495652_0041209 3300046529 Bacteria 3987
115 Ga0495640_0028941 3300046533 Bacteria 3983
116 Ga0495586_0012269 3300046535 Bacteria 4548
117 Ga0495587_0023382 3300046536 Bacteria 3797
118 Ga0495645_0037783 3300046543 Bacteria 3520
119 Ga0495645_0182963 3300046543 Bacteria 1434
120 Ga0495667_0035854 3300046559 Bacteria 3314
121 Ga0495623_0034578 3300046679 Bacteria 3240
122 Ga0495646_0015523 3300046680 Bacteria 4833
123 Ga0495613_0129558 3300046689 Bacteria 1807
124 Ga0495600_0004020 3300046809 Bacteria 8740
125 Ga0495600_0033494 3300046809 Bacteria 3335
126 Ga0495604_0046992 3300047317 Bacteria 3363
127 Ga0495674_0064029 3300047319 Bacteria 3197
128 Ga0495675_0032344 3300047444 Bacteria 3337
129 Ga0495684_0020544 3300047471 Bacteria 5089
130 Ga0495602_0036934 3300048088 Bacteria 4540
131 Ga0496115_0182574 3300048918 Bacteria 1734
132 Ga0496121_0055490 3300048924 Bacteria 3300
133 Ga0496121_0189283 3300048924 Bacteria 1477
134 Ga0496126_0101708 3300048929 Bacteria 2513
135 Ga0501034_0003301 3300049571 Bacteria 18425
136 Ga0501034_0008640 3300049571 Bacteria 10742
137 Ga0501036_0000392 3300049572 Bacteria 30820
138 Ga0501037_0046863 3300049573 Bacteria 3169
139 Ga0501038_0016634 3300049574 Bacteria 6667
140 Ga0501042_0016127 3300049578 Bacteria 5126
141 Ga0501043_0008154 3300049579 Bacteria 8268
142 Ga0501047_0014730 3300049581 Bacteria 7441
143 Ga0501048_0002250 3300049582 Bacteria 14711
144 Ga0501073_0335761 3300049589 Bacteria 1043
145 Ga0501044_0020065 3300049823 Bacteria 7136
146 nmdc:mga07m45_255876_c1 3300050496 Bacteria 1018
147 Ga0500578_0050680 3300053086 Bacteria 2662
148 Ga0500644_0011154 3300053088 Bacteria 2451
149 Ga0500651_0136458 3300053093 Bacteria 1481
150 Ga0500569_025608 3300053109 Bacteria 1608
151 Ga0500594_0036296 3300053118 Bacteria 1326
152 Ga0500621_056522 3300053126 Bacteria 1587
153 Ga0500616_0000621 3300053153 Bacteria 43064
154 Ga0500616_0006104 3300053153 Bacteria 7974
155 Ga0500599_001263 3300053736 Bacteria 2892
156 2644505982 2643221690 Bacteria 4654705
157 2808903430 2808606372 Bacteria 4649509
158 2837272562 2837268691 Bacteria 7850704
159 2884997941 2884994152 Bacteria 4492978
160 2891397246 2891395885 Bacteria 9251614
161 8055174099 8055172936 Bacteria 9305943
162 Ga0466960_0083096
163 JGI25406J46586_10001631
164 JGI25407J50210_10010661
165 Ga0070667_100173826
166 Ga0070709_10062025
167 Ga0070709_10254965
168 Ga0070714_100019251
169 Ga0070714_100095387
170 Ga0070714_100161377
171 Ga0070714_100550944
172 Ga0070713_100099066
173 Ga0070713_100157914
174 Ga0070713_100171201
175 Ga0070713_100362363
176 Ga0070710_10066599
177 Ga0070710_10068974
178 Ga0070711_100138981
179 Ga0070711_100176996
180 Ga0070708_100108654
181 Ga0070707_100058295
182 Ga0070698_100003958
183 Ga0070699_100136522
184 Ga0068861_100209771
185 Ga0081538_10001847
186 Ga0081538_10016959
187 Ga0081540_1022724
188 Ga0081540_1070814
189 Ga0081539_10001458
190 Ga0070717_10248929
191 Ga0070716_100057770
192 Ga0070712_100035775
193 Ga0105243_10292800
194 Ga0105237_10441368
195 Ga0105249_10771942
196 Ga0105239_10112487
197 Ga0157376_10294952
198 Ga0213875_10001206
199 Ga0207692_10029564
200 Ga0207692_10218679
201 Ga0207699_10078187
202 Ga0207699_10153880
203 Ga0207699_10174843
204 Ga0207693_10042263
205 Ga0207663_10219987
206 Ga0207663_10270568
207 Ga0207646_10051055
208 Ga0207700_10280608
209 Ga0207700_10298901
210 Ga0207664_10108252
211 Ga0207698_10542366
212 Ga0265334_10029712
213 Ga0265318_10000774
214 Ga0265318_10001889
215 Ga0307515_10006821
216 Ga0265338_10004551
217 Ga0265338_10007407
218 Ga0265338_10028923
219 Ga0307512_10002634
220 Ga0307512_10010048
221 Ga0307512_10011882
222 Ga0265330_10000484
223 Ga0265330_10007876
224 Ga0265330_10051125
225 Ga0265332_10000504
226 Ga0265320_10000587
227 Ga0265320_10132207
228 Ga0265325_10009127
229 Ga0265329_10001304
230 Ga0265340_10003114
231 Ga0265340_10019199
232 Ga0265340_10041993
233 Ga0265340_10049679
234 Ga0265339_10005188
235 Ga0265339_10029546
236 Ga0265331_10001185
237 Ga0265327_10051376
238 Ga0265316_10003999
239 Ga0265316_10018463
240 Ga0307513_10021867
241 Ga0265313_10000078
242 Ga0265313_10000196
243 Ga0265313_10005456
244 Ga0265313_10022226
245 Ga0265313_10058720
246 Ga0307508_10101199
247 Ga0307508_10227299
248 Ga0265314_10000967
249 Ga0265314_10003197
250 Ga0265314_10012072
251 Ga0265314_10044428
252 Ga0265342_10000690
253 Ga0265342_10186402
254 Ga0307410_10028739
255 Ga0307507_10159929
256 Ga0373951_0000017
257 Ga0436364_0746122
258 Ga0451789_0485963
259 Ga0451793_1148868
260 Ga0451793_1278335
261 Ga0451802_0426543
262 Ga0466961_0022154
263 Ga0495592_0033725
264 Ga0495592_0129670
265 Ga0495651_0027134
266 Ga0495651_0047268
267 Ga0495653_0208766
268 Ga0495664_0036151
269 Ga0495594_0041620
270 Ga0495628_0078833
271 Ga0495628_0116077
272 Ga0495630_0045193
273 Ga0495666_0001104
274 Ga0495652_0004335
275 Ga0495652_0041209
276 Ga0495640_0028941
277 Ga0495586_0012269
278 Ga0495587_0023382
279 Ga0495645_0037783
280 Ga0495645_0182963
281 Ga0495667_0035854
282 Ga0495623_0034578
283 Ga0495646_0015523
284 Ga0495613_0129558
285 Ga0495600_0004020
286 Ga0495600_0033494
287 Ga0495604_0046992
288 Ga0495674_0064029
289 Ga0495675_0032344
290 Ga0495684_0020544
291 Ga0495602_0036934
292 Ga0496115_0182574
293 Ga0496121_0055490
294 Ga0496121_0189283
295 Ga0496126_0101708
296 Ga0501034_0003301
297 Ga0501034_0008640
298 Ga0501036_0000392
299 Ga0501037_0046863
300 Ga0501038_0016634
301 Ga0501042_0016127
302 Ga0501043_0008154
303 Ga0501047_0014730
304 Ga0501048_0002250
305 Ga0501073_0335761
306 Ga0501044_0020065
307 nmdc:mga07m45_255876_c1
308 Ga0500578_0050680
309 Ga0500644_0011154
310 Ga0500651_0136458
311 Ga0500569_025608
312 Ga0500594_0036296
313 Ga0500621_056522
314 Ga0500616_0000621
315 Ga0500616_0006104
316 Ga0500599_001263
317 2644505982
318 2808903430
319 2837272562
320 2884997941
321 2891397246
322 8055174099

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

32

79

0.93

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

34

261

0.6

Structural Annotation

Top 5 Hits

ID Description Score Start End
7jqx-assembly1.cif.gz_A crystal structure of cfl1 wild-type from burkholderia cenocepacia 0.9141 4 290
7jqy-assembly1.cif.gz_B crystal structure of cfl1-d123s from burkholderia cenocepacia 0.9132 4 290
8b6o-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) fused to m13 0.9124 14 133
3pi6-assembly2.cif.gz_D crystal structure of the cftr inhibitory factor cif with the h177y mutation 0.9116 8 290
3kda-assembly2.cif.gz_B crystal structure of the cftr inhibitory factor cif with the h269a mutation 0.9112 8 290
ID Description Score Start End Superfamily
af_A0A0R0KMM0_1_93_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9026 10 99 3.40.50.12270
af_A0A0R0EQP0_201_384_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8922 32 135 3.40.50.1820
3kd2B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.891 13 289 3.40.50.1820
4mebB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8811 8 289 3.40.50.1820
af_Q4CQ94_14_186_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.878 25 133 3.40.50.12270
ID Description Score Start End GO Terms
AF-A0A538CSF8-F1-model_v4 Alpha/beta hydrolase 0.9628 19 133 GO:0016020
GO:0016787
AF-A0A377LX29-F1-model_v4 Putative hydrolase (EC 3.3.2.10) 0.9623 13 137 GO:0004301
AF-A0A534P7V0-F1-model_v4 Alpha/beta hydrolase 0.9534 16 125 GO:0016787
AF-A0A7J2IRY7-F1-model_v4 Alpha/beta hydrolase 0.9483 17 130 GO:0016020
GO:0016787
AF-A0A2N2YBN3-F1-model_v4 Alpha/beta hydrolase 0.9461 14 131 GO:0016020
GO:0016787

Map