F236723

General Info

Members Datasets Scaffolds Average Seq Length
161 120 160 352

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100183910|Ga0075431_1001839102
Length 392
Sequence VPGLIRAMNKRPKTRAAAFFALALASLSLAACGQGGDEPSQTTTKATAFGGNTTTQTGNAPIPVSPRGGPLKTVLWGAQIGDQLTGTAPPYDMSAVSKFERIAGKKLAILGFASPFQDCTSGKCTFLDFAADLFERVRQHGSIPLISWASDSIPASTDQPQFQLRDVTAGRYDNYIRKWAIAARDWGHPFFLRFNWEMNGFWFPWGVGANGNRTADFVPAWRHVHDIFTSVGATNATWVWCPNIDLHKPPADLRPLYPGDKYVDWTCLDGFNWGIRSGSPGWLSFREIFGDSYRRLRQLVPDKPIMLGEMASSNSGGDKVSWIRDMLTTMPTEFPGIHAFVWLDVHDRGTNWPIETSNAVASEFRRGIARRAYLANDYGNLDTSPIPPPDQG

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
29 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
40 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
41 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
42 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
68 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
69 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
70 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
71 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
72 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
73 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
74 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
75 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
76 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
77 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
78 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
79 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
80 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
81 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
82 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
83 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
84 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
85 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
86 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
87 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
88 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
89 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
90 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
91 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
92 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
93 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
94 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
95 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
96 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
97 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
98 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
99 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
100 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
101 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
102 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
103 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
104 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
105 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
106 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
107 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
108 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
109 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
110 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
111 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
112 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
113 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
114 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
115 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
116 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
117 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
118 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
119 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
120 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 14.91
Rhizosphere 83.23
Stem 0
Stem Tuber 0
Unclassified 1.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10003385 3300001979 Bacteria 7024
2 Ga0070683_100002880 3300005329 Bacteria 13782
3 Ga0070683_100029624 3300005329 Bacteria 4959
4 Ga0070666_10025245 3300005335 Bacteria 3873
5 Ga0070682_100000117 3300005337 Bacteria 69662
6 Ga0068868_100000541 3300005338 Bacteria 25367
7 Ga0070661_100000344 3300005344 Bacteria 36955
8 Ga0070673_100017407 3300005364 Bacteria 5110
9 Ga0070688_100000208 3300005365 Bacteria 30978
10 Ga0070688_100000256 3300005365 Bacteria 27953
11 Ga0070659_100021766 3300005366 Bacteria 4888
12 Ga0070713_100000186 3300005436 Bacteria 41000
13 Ga0070681_10010667 3300005458 Bacteria 9081
14 Ga0070685_10000178 3300005466 Bacteria 42333
15 Ga0070685_10000355 3300005466 Bacteria 27953
16 Ga0070679_100000068 3300005530 Bacteria 77184
17 Ga0070684_100014993 3300005535 Bacteria 6295
18 Ga0070684_100029524 3300005535 Bacteria 4648
19 Ga0068853_100065396 3300005539 Bacteria 3156
20 Ga0070665_100002351 3300005548 Bacteria 20915
21 Ga0070665_100102918 3300005548 Bacteria 2859
22 Ga0068855_100272665 3300005563 Unclassified 1881
23 Ga0068854_100000095 3300005578 Bacteria 61892
24 Ga0068854_100102305 3300005578 Unclassified 2149
25 Ga0068852_100000093 3300005616 Bacteria 60834
26 Ga0068851_10002379 3300005834 Bacteria 8265
27 Ga0068851_10008802 3300005834 Bacteria 4677
28 Ga0068863_100005074 3300005841 Bacteria 12987
29 Ga0070715_10041963 3300006163 Bacteria 1920
30 Ga0070712_100001375 3300006175 Bacteria 14754
31 Ga0075431_100183910 3300006847 Bacteria 2144
32 Ga0075433_10001323 3300006852 Bacteria 18133
33 Ga0068865_100000592 3300006881 Bacteria 20337
34 Ga0105245_10000266 3300009098 Bacteria 49944
35 Ga0105247_10000628 3300009101 Bacteria 28197
36 Ga0105242_10091007 3300009176 Bacteria 2568
37 Ga0105248_10000008 3300009177 Bacteria 403910
38 Ga0105238_10000011 3300009551 Bacteria 261080
39 Ga0105249_10000203 3300009553 Bacteria 67783
40 Ga0105239_10014255 3300010375 Bacteria 8825
41 Ga0105239_10306339 3300010375 Unclassified 1789
42 Ga0157371_10002088 3300013102 Bacteria 19521
43 Ga0157370_10035926 3300013104 Bacteria 4812
44 Ga0157369_10000020 3300013105 Bacteria 241679
45 Ga0157378_10003549 3300013297 Bacteria 13820
46 Ga0157378_10009501 3300013297 Bacteria 8468
47 Ga0157378_10113139 3300013297 Bacteria 2491
48 Ga0157372_10000112 3300013307 Bacteria 85902
49 Ga0157379_10031153 3300014968 Bacteria 4751
50 Ga0157376_10015575 3300014969 Bacteria 5748
51 Ga0157376_10201748 3300014969 Unclassified 1830
52 Ga0163161_10000357 3300017792 Bacteria 38514
53 Ga0207656_10000834 3300025321 Bacteria 10065
54 Ga0207656_10006160 3300025321 Bacteria 4296
55 Ga0207710_10000239 3300025900 Bacteria 46663
56 Ga0207685_10043751 3300025905 Bacteria 1689
57 Ga0207693_10004139 3300025915 Bacteria 12313
58 Ga0207649_10000009 3300025920 Bacteria 295544
59 Ga0207652_10000044 3300025921 Bacteria 127779
60 Ga0207694_10000004 3300025924 Bacteria 967075
61 Ga0207687_10000007 3300025927 Bacteria 604185
62 Ga0207700_10000027 3300025928 Bacteria 137708
63 Ga0207690_10006715 3300025932 Bacteria 6817
64 Ga0207686_10000718 3300025934 Bacteria 20545
65 Ga0207686_10067855 3300025934 Bacteria 2283
66 Ga0207670_10049178 3300025936 Bacteria 2819
67 Ga0207704_10000157 3300025938 Bacteria 36439
68 Ga0207711_10000006 3300025941 Bacteria 792692
69 Ga0207661_10000139 3300025944 Bacteria 45892
70 Ga0207667_10229986 3300025949 Unclassified 1899
71 Ga0207712_10000007 3300025961 Bacteria 539589
72 Ga0207640_10000038 3300025981 Bacteria 108630
73 Ga0207640_10063357 3300025981 Bacteria 2457
74 Ga0207658_10058877 3300025986 Bacteria 2861
75 Ga0207677_10000340 3300026023 Bacteria 33455
76 Ga0207678_10257260 3300026067 Bacteria 1496
77 Ga0207641_10003641 3300026088 Bacteria 13588
78 Ga0207698_10000013 3300026142 Bacteria 255414
79 Ga0268266_10000640 3300028379 Bacteria 47545
80 Ga0268266_10088813 3300028379 Bacteria 2705
81 Ga0268265_10191364 3300028380 Unclassified 1767
82 Ga0373937_0035582 3300036401 Bacteria 4534
83 Ga0451807_2684618 3300041486 Bacteria 3832
84 Ga0466957_0007287 3300044842 Bacteria 6251
85 Ga0495629_0000381 3300046459 Bacteria 37177
86 Ga0495629_0140087 3300046459 Bacteria 1683
87 Ga0495641_0040858 3300046461 Bacteria 2156
88 Ga0495662_0000019 3300046476 Bacteria 55148
89 Ga0495662_0094151 3300046476 Bacteria 1463
90 Ga0495608_0000125 3300046511 Bacteria 54881
91 Ga0495608_0004591 3300046511 Bacteria 9859
92 Ga0495608_0067687 3300046511 Bacteria 2336
93 Ga0495628_0044849 3300046516 Bacteria 3516
94 Ga0495628_0050838 3300046516 Bacteria 3278
95 Ga0495630_0000020 3300046517 Bacteria 176389
96 Ga0495630_0003550 3300046517 Bacteria 10861
97 Ga0495652_0030781 3300046529 Bacteria 4703
98 Ga0495640_0028648 3300046533 Bacteria 4007
99 Ga0495586_0000161 3300046535 Bacteria 43544
100 Ga0495587_0009351 3300046536 Bacteria 6284
101 Ga0495645_0028577 3300046543 Bacteria 4053
102 Ga0495667_0000018 3300046559 Bacteria 188610
103 Ga0495634_0000561 3300046642 Bacteria 36353
104 Ga0495635_0000044 3300046663 Bacteria 83945
105 Ga0495588_0000340 3300046674 Bacteria 30427
106 Ga0495657_0000004 3300046675 Bacteria 266465
107 Ga0495657_0011598 3300046675 Bacteria 6585
108 Ga0495647_0000018 3300046681 Bacteria 81701
109 Ga0495647_0002412 3300046681 Bacteria 5889
110 Ga0495669_0000033 3300046684 Bacteria 98629
111 Ga0495613_0000179 3300046689 Bacteria 62109
112 Ga0495624_0000073 3300046690 Bacteria 65582
113 Ga0495624_0000097 3300046690 Bacteria 58715
114 Ga0495649_0000751 3300046694 Bacteria 26125
115 Ga0495604_0000137 3300047317 Bacteria 62542
116 Ga0495674_0000064 3300047319 Bacteria 71275
117 Ga0495676_0107182 3300047321 Bacteria 2057
118 Ga0495680_0000496 3300047322 Bacteria 44440
119 Ga0495680_0001082 3300047322 Bacteria 30201
120 Ga0495680_0005380 3300047322 Bacteria 12069
121 Ga0495675_0000175 3300047444 Bacteria 46609
122 Ga0495593_0043160 3300047673 Bacteria 2418
123 Ga0495593_0157357 3300047673 Bacteria 1148
124 Ga0496100_0000002 3300048903 Bacteria 489057
125 Ga0496101_0000001 3300048904 Bacteria 489057
126 Ga0496102_0000039 3300048905 Bacteria 198306
127 Ga0496102_0008087 3300048905 Bacteria 8997
128 Ga0496103_0000008 3300048906 Bacteria 340474
129 Ga0496104_0000004 3300048907 Bacteria 641830
130 Ga0496104_0000009 3300048907 Bacteria 488055
131 Ga0496105_0000001 3300048908 Bacteria 1328178
132 Ga0496105_0000007 3300048908 Bacteria 339658
133 Ga0496106_0000110 3300048909 Bacteria 63946
134 Ga0496107_0000003 3300048910 Bacteria 304038
135 Ga0496109_0000121 3300048912 Bacteria 81487
136 Ga0496109_0000568 3300048912 Bacteria 30898
137 Ga0496110_0000388 3300048913 Bacteria 29649
138 Ga0496110_0019958 3300048913 Bacteria 5650
139 Ga0496110_0032745 3300048913 Bacteria 4493
140 Ga0496111_0000019 3300048914 Bacteria 68278
141 Ga0496112_0001972 3300048915 Bacteria 16214
142 Ga0496112_0238715 3300048915 Bacteria 1771
143 Ga0496113_0000073 3300048916 Bacteria 44302
144 Ga0496113_0046203 3300048916 Bacteria 3232
145 Ga0496114_0251304 3300048917 Unclassified 1556
146 Ga0496117_0001757 3300048920 Bacteria 29817
147 Ga0496118_0000550 3300048921 Bacteria 61734
148 Ga0496119_0017993 3300048922 Bacteria 5285
149 nmdc:mga06r32_76600_c1 3300050510 Bacteria 3248
150 nmdc:mga0a205_1451_c1 3300050515 Bacteria 20201
151 Ga0495601_0000013 3300053077 Bacteria 226476
152 Ga0495601_0000364 3300053077 Bacteria 23907
153 Ga0495612_0000060 3300053078 Bacteria 49047
154 Ga0495612_0048094 3300053078 Bacteria 1748
155 Ga0495655_0009284 3300053083 Bacteria 1901
156 Ga0495595_0000003 3300053084 Bacteria 266465
157 Ga0495595_0000053 3300053084 Bacteria 59851
158 Ga0495619_0000031 3300053085 Bacteria 145508
159 Ga0495619_0000116 3300053085 Bacteria 58748
160 Ga0495619_0054987 3300053085 Bacteria 2636

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009177 Ga0105248_10000008 Ga0105248_10000008324 307
2 3300013102 Ga0157371_10002088 Ga0157371_100020882 308
3 3300046461 Ga0495641_0040858 Ga0495641_0040858_869_1798 308
4 3300046543 Ga0495645_0028577 Ga0495645_0028577_1414_2361 315
5 3300048915 Ga0496112_0238715 Ga0496112_0238715_236_1270 317
6 3300005365 Ga0070688_100000208 Ga0070688_10000020821 322
7 3300005466 Ga0070685_10000178 Ga0070685_1000017829 322
8 3300009098 Ga0105245_10000266 Ga0105245_1000026612 322
9 3300025927 Ga0207687_10000007 Ga0207687_10000007416 322
10 3300005329 Ga0070683_100002880 Ga0070683_1000028806 323
11 3300013297 Ga0157378_10003549 Ga0157378_100035496 323
12 3300025944 Ga0207661_10000139 Ga0207661_1000013927 323
13 3300005841 Ga0068863_100005074 Ga0068863_1000050745 324
14 3300026088 Ga0207641_10003641 Ga0207641_100036417 324
15 3300048905 Ga0496102_0000039 Ga0496102_0000039_67790_68881 324
16 3300048906 Ga0496103_0000008 Ga0496103_0000008_189045_190136 324
17 3300013105 Ga0157369_10000020 Ga0157369_10000020208 325
18 3300010375 Ga0105239_10306339 Ga0105239_103063392 326
19 3300014969 Ga0157376_10201748 Ga0157376_102017482 327
20 3300048907 Ga0496104_0000009 Ga0496104_0000009_240273_241328 328
21 3300048908 Ga0496105_0000007 Ga0496105_0000007_246728_247783 328
22 3300028380 Ga0268265_10191364 Ga0268265_101913642 330
23 3300047319 Ga0495674_0000064 Ga0495674_0000064_16858_17952 332
24 3300005539 Ga0068853_100065396 Ga0068853_1000653963 334
25 3300013104 Ga0157370_10035926 Ga0157370_100359264 334
26 3300044842 Ga0466957_0007287 Ga0466957_0007287_4526_5623 334
27 3300005335 Ga0070666_10025245 Ga0070666_100252453 335
28 3300005563 Ga0068855_100272665 Ga0068855_1002726652 335
29 3300025949 Ga0207667_10229986 Ga0207667_102299861 335
30 3300025986 Ga0207658_10058877 Ga0207658_100588772 335
31 3300046476 Ga0495662_0000019 Ga0495662_0000019_1375_2469 335
32 3300005337 Ga0070682_100000117 Ga0070682_1000001179 336
33 3300006163 Ga0070715_10041963 Ga0070715_100419632 336
34 3300025905 Ga0207685_10043751 Ga0207685_100437512 336
35 3300046559 Ga0495667_0000018 Ga0495667_0000018_113947_115035 336
36 3300047322 Ga0495680_0005380 Ga0495680_0005380_2640_3728 336
37 3300050515 nmdc:mga0a205_1451_c1 nmdc:mga0a205_1451_c1_2784_3797 336
38 3300053085 Ga0495619_0000031 Ga0495619_0000031_139055_140149 336
39 3300006881 Ga0068865_100000592 Ga0068865_1000005923 337
40 3300025938 Ga0207704_10000157 Ga0207704_1000015729 337
41 3300048915 Ga0496112_0001972 Ga0496112_0001972_10225_11319 337
42 3300048916 Ga0496113_0000073 Ga0496113_0000073_27443_28537 337
43 3300046642 Ga0495634_0000561 Ga0495634_0000561_32104_33195 338
44 3300047321 Ga0495676_0107182 Ga0495676_0107182_56_1138 338
45 3300048903 Ga0496100_0000002 Ga0496100_0000002_351388_352443 338
46 3300048904 Ga0496101_0000001 Ga0496101_0000001_351388_352443 338
47 3300048909 Ga0496106_0000110 Ga0496106_0000110_158_1213 338
48 3300048910 Ga0496107_0000003 Ga0496107_0000003_131_1186 338
49 3300048913 Ga0496110_0000388 Ga0496110_0000388_2245_3339 338
50 3300048914 Ga0496111_0000019 Ga0496111_0000019_26321_27415 338
51 3300005535 Ga0070684_100014993 Ga0070684_1000149932 339
52 3300046516 Ga0495628_0050838 Ga0495628_0050838_1412_2470 339
53 3300013307 Ga0157372_10000112 Ga0157372_1000011269 340
54 3300010375 Ga0105239_10014255 Ga0105239_100142557 341
55 3300047673 Ga0495593_0043160 Ga0495593_0043160_203_1288 341
56 3300047673 Ga0495593_0157357 Ga0495593_0157357_14_1072 341
57 3300025961 Ga0207712_10000007 Ga0207712_10000007363 342
58 3300005366 Ga0070659_100021766 Ga0070659_1000217662 344
59 3300025932 Ga0207690_10006715 Ga0207690_100067155 344
60 3300046535 Ga0495586_0000161 Ga0495586_0000161_36946_38130 344
61 3300005834 Ga0068851_10002379 Ga0068851_100023796 345
62 3300006175 Ga0070712_100001375 Ga0070712_1000013752 345
63 3300025321 Ga0207656_10000834 Ga0207656_100008345 345
64 3300025915 Ga0207693_10004139 Ga0207693_100041392 345
65 3300028379 Ga0268266_10088813 Ga0268266_100888132 345
66 3300005578 Ga0068854_100102305 Ga0068854_1001023051 346
67 3300009176 Ga0105242_10091007 Ga0105242_100910072 346
68 3300025934 Ga0207686_10067855 Ga0207686_100678552 346
69 3300025981 Ga0207640_10063357 Ga0207640_100633572 346
70 3300046684 Ga0495669_0000033 Ga0495669_0000033_15853_16905 346
71 3300046690 Ga0495624_0000097 Ga0495624_0000097_9822_10871 346
72 3300047322 Ga0495680_0001082 Ga0495680_0001082_2281_3375 346
73 3300005365 Ga0070688_100000256 Ga0070688_10000025618 347
74 3300005458 Ga0070681_10010667 Ga0070681_100106678 347
75 3300005466 Ga0070685_10000355 Ga0070685_1000035518 347
76 3300005530 Ga0070679_100000068 Ga0070679_10000006839 347
77 3300025921 Ga0207652_10000044 Ga0207652_1000004442 347
78 3300046536 Ga0495587_0009351 Ga0495587_0009351_1352_2455 347
79 3300046681 Ga0495647_0000018 Ga0495647_0000018_28214_29269 347
80 3300047322 Ga0495680_0000496 Ga0495680_0000496_21988_23043 347
81 3300005338 Ga0068868_100000541 Ga0068868_1000005418 348
82 3300005548 Ga0070665_100102918 Ga0070665_1001029182 348
83 3300026023 Ga0207677_10000340 Ga0207677_1000034014 348
84 3300036401 Ga0373937_0035582 Ga0373937_0035582_108_1166 348
85 3300046694 Ga0495649_0000751 Ga0495649_0000751_14981_16039 348
86 3300005548 Ga0070665_100002351 Ga0070665_1000023513 349
87 3300028379 Ga0268266_10000640 Ga0268266_1000064027 349
88 3300046516 Ga0495628_0044849 Ga0495628_0044849_454_1542 349
89 3300046529 Ga0495652_0030781 Ga0495652_0030781_3596_4684 349
90 3300046681 Ga0495647_0002412 Ga0495647_0002412_3927_4985 349
91 3300046517 Ga0495630_0000020 Ga0495630_0000020_31238_32299 350
92 3300009551 Ga0105238_10000011 Ga0105238_10000011175 351
93 3300025924 Ga0207694_10000004 Ga0207694_10000004447 351
94 3300048907 Ga0496104_0000004 Ga0496104_0000004_305823_306953 351
95 3300048908 Ga0496105_0000001 Ga0496105_0000001_334878_336008 351
96 3300048922 Ga0496119_0017993 Ga0496119_0017993_1118_2248 351
97 3300009553 Ga0105249_10000203 Ga0105249_1000020324 352
98 3300014968 Ga0157379_10031153 Ga0157379_100311533 352
99 3300026067 Ga0207678_10257260 Ga0207678_102572601 352
100 3300046476 Ga0495662_0094151 Ga0495662_0094151_100_1242 352
101 3300048905 Ga0496102_0008087 Ga0496102_0008087_1329_2396 352
102 3300048912 Ga0496109_0000121 Ga0496109_0000121_26462_27565 352
103 3300048913 Ga0496110_0032745 Ga0496110_0032745_1199_2326 352
104 3300048916 Ga0496113_0046203 Ga0496113_0046203_666_1739 352
105 3300048920 Ga0496117_0001757 Ga0496117_0001757_17084_18151 352
106 3300048921 Ga0496118_0000550 Ga0496118_0000550_47960_49027 352
107 3300050510 nmdc:mga06r32_76600_c1 nmdc:mga06r32_76600_c1_1588_2715 352
108 3300014969 Ga0157376_10015575 Ga0157376_100155753 353
109 3300048912 Ga0496109_0000568 Ga0496109_0000568_29430_30503 353
110 3300005436 Ga0070713_100000186 Ga0070713_10000018627 354
111 3300005616 Ga0068852_100000093 Ga0068852_10000009346 354
112 3300005834 Ga0068851_10008802 Ga0068851_100088022 354
113 3300013297 Ga0157378_10113139 Ga0157378_101131391 354
114 3300025321 Ga0207656_10006160 Ga0207656_100061603 354
115 3300025928 Ga0207700_10000027 Ga0207700_1000002770 354
116 3300025936 Ga0207670_10049178 Ga0207670_100491782 354
117 3300025941 Ga0207711_10000006 Ga0207711_10000006718 354
118 3300026142 Ga0207698_10000013 Ga0207698_1000001324 354
119 3300046674 Ga0495588_0000340 Ga0495588_0000340_7075_8184 354
120 3300047317 Ga0495604_0000137 Ga0495604_0000137_30229_31323 354
121 3300013297 Ga0157378_10009501 Ga0157378_100095015 355
122 3300046511 Ga0495608_0067687 Ga0495608_0067687_810_1901 355
123 3300046690 Ga0495624_0000073 Ga0495624_0000073_5517_6671 355
124 3300053078 Ga0495612_0000060 Ga0495612_0000060_37905_38996 355
125 3300053083 Ga0495655_0009284 Ga0495655_0009284_163_1254 355
126 3300053085 Ga0495619_0054987 Ga0495619_0054987_97_1188 355
127 3300005344 Ga0070661_100000344 Ga0070661_1000003444 356
128 3300005578 Ga0068854_100000095 Ga0068854_10000009539 356
129 3300025920 Ga0207649_10000009 Ga0207649_10000009253 356
130 3300025981 Ga0207640_10000038 Ga0207640_1000003873 356
131 3300046511 Ga0495608_0000125 Ga0495608_0000125_31139_32236 356
132 3300046675 Ga0495657_0000004 Ga0495657_0000004_154560_155657 356
133 3300046689 Ga0495613_0000179 Ga0495613_0000179_54986_56086 356
134 3300047444 Ga0495675_0000175 Ga0495675_0000175_5631_6728 356
135 3300053077 Ga0495601_0000013 Ga0495601_0000013_52233_53333 356
136 3300053084 Ga0495595_0000003 Ga0495595_0000003_154560_155657 356
137 3300053085 Ga0495619_0000116 Ga0495619_0000116_1327_2424 356
138 3300006852 Ga0075433_10001323 Ga0075433_1000132311 357
139 3300041486 Ga0451807_2684618 Ga0451807_2684618_2383_3519 357
140 3300046459 Ga0495629_0000381 Ga0495629_0000381_29848_30948 358
141 3300046517 Ga0495630_0003550 Ga0495630_0003550_7369_8469 358
142 3300046675 Ga0495657_0011598 Ga0495657_0011598_3678_4778 358
143 3300048913 Ga0496110_0019958 Ga0496110_0019958_1240_2340 358
144 3300048917 Ga0496114_0251304 Ga0496114_0251304_236_1336 358
145 3300053077 Ga0495601_0000364 Ga0495601_0000364_19465_20565 358
146 3300053078 Ga0495612_0048094 Ga0495612_0048094_632_1732 358
147 3300006847 Ga0075431_100183910 Ga0075431_1001839102 359
148 3300048913 Ga0496110_0032745 Ga0496110_0032745_2452_3609 359
149 3300005364 Ga0070673_100017407 Ga0070673_1000174074 360
150 3300046459 Ga0495629_0140087 Ga0495629_0140087_184_1272 360
151 3300017792 Ga0163161_10000357 Ga0163161_1000035732 361
152 3300046511 Ga0495608_0004591 Ga0495608_0004591_5287_6381 361
153 3300046533 Ga0495640_0028648 Ga0495640_0028648_2611_3705 361
154 3300046663 Ga0495635_0000044 Ga0495635_0000044_28480_29574 361
155 3300053084 Ga0495595_0000053 Ga0495595_0000053_44306_45400 361
156 3300009101 Ga0105247_10000628 Ga0105247_1000062818 363
157 3300025900 Ga0207710_10000239 Ga0207710_1000023926 363
158 3300005535 Ga0070684_100029524 Ga0070684_1000295244 369
159 3300005329 Ga0070683_100029624 Ga0070683_1000296242 373
160 3300025934 Ga0207686_10000718 Ga0207686_100007185 377
161 3300001979 JGI24740J21852_10003385 JGI24740J21852_100033855 378

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02156

Glyco_hydro_26

Glycosyl hydrolase family 26

72

290

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cip-assembly1.cif.gz_A structure of the michaelis complex of a family 26 lichenase 0.91 42 341
2cip-assembly1.cif.gz_A structure of the michaelis complex of a family 26 lichenase 0.9068 42 341
2vi0-assembly1.cif.gz_A lichenase ctlic26 in complex with a thio-oligosaccharide 0.9063 44 341
2v3g-assembly1.cif.gz_A structure of a family 26 lichenase in complex with noeuromycin 0.9017 44 339
2vi0-assembly1.cif.gz_A lichenase ctlic26 in complex with a thio-oligosaccharide 0.8999 44 341
ID Description Score Start End Superfamily
2cipA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.91 42 341 3.20.20.80
2cipA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9068 42 341 3.20.20.80
4yn5A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.7359 43 357 3.20.20.80
3zm8A02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.7052 43 349 3.20.20.80
6hpfA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.6847 43 347 3.20.20.80
ID Description Score Start End GO Terms
AF-A0A067LZ12-F1-model_v4 deleted 0.943 44 340
AF-A0A810MFD9-F1-model_v4 deleted 0.941 227 343
AF-A0A399RFR0-F1-model_v4 Beta-mannanase 0.932 42 340 GO:0006080
GO:0016985
AF-A0JT99-F1-model_v4 Beta-mannanase-like protein 0.929 42 340 GO:0006080
GO:0016985
AF-A0A661KV64-F1-model_v4 GH26 domain-containing protein 0.9275 195 344 GO:0006080
GO:0016985

Feature Viewer

pLDDT pTM Quality
82.7 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map