F236723
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 161 | 120 | 160 | 352 |
Family's Representative Sequence
| Representative Sequence | 3300006847|Ga0075431_100183910|Ga0075431_1001839102 |
| Length | 392 |
| Sequence | VPGLIRAMNKRPKTRAAAFFALALASLSLAACGQGGDEPSQTTTKATAFGGNTTTQTGNAPIPVSPRGGPLKTVLWGAQIGDQLTGTAPPYDMSAVSKFERIAGKKLAILGFASPFQDCTSGKCTFLDFAADLFERVRQHGSIPLISWASDSIPASTDQPQFQLRDVTAGRYDNYIRKWAIAARDWGHPFFLRFNWEMNGFWFPWGVGANGNRTADFVPAWRHVHDIFTSVGATNATWVWCPNIDLHKPPADLRPLYPGDKYVDWTCLDGFNWGIRSGSPGWLSFREIFGDSYRRLRQLVPDKPIMLGEMASSNSGGDKVSWIRDMLTTMPTEFPGIHAFVWLDVHDRGTNWPIETSNAVASEFRRGIARRAYLANDYGNLDTSPIPPPDQG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 6 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 16 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 18 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 19 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 20 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 21 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 22 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 25 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 26 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 27 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 68 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 69 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 70 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 71 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 72 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 73 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 74 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 75 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 76 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 77 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 98 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 99 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 100 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 101 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 102 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 103 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 104 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 105 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 106 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 107 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 108 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 109 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 110 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 111 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 112 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 113 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 114 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 115 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 116 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 14.91 |
| Rhizosphere | 83.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.86 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10003385 | 3300001979 | Bacteria | 7024 |
| 2 | Ga0070683_100002880 | 3300005329 | Bacteria | 13782 |
| 3 | Ga0070683_100029624 | 3300005329 | Bacteria | 4959 |
| 4 | Ga0070666_10025245 | 3300005335 | Bacteria | 3873 |
| 5 | Ga0070682_100000117 | 3300005337 | Bacteria | 69662 |
| 6 | Ga0068868_100000541 | 3300005338 | Bacteria | 25367 |
| 7 | Ga0070661_100000344 | 3300005344 | Bacteria | 36955 |
| 8 | Ga0070673_100017407 | 3300005364 | Bacteria | 5110 |
| 9 | Ga0070688_100000208 | 3300005365 | Bacteria | 30978 |
| 10 | Ga0070688_100000256 | 3300005365 | Bacteria | 27953 |
| 11 | Ga0070659_100021766 | 3300005366 | Bacteria | 4888 |
| 12 | Ga0070713_100000186 | 3300005436 | Bacteria | 41000 |
| 13 | Ga0070681_10010667 | 3300005458 | Bacteria | 9081 |
| 14 | Ga0070685_10000178 | 3300005466 | Bacteria | 42333 |
| 15 | Ga0070685_10000355 | 3300005466 | Bacteria | 27953 |
| 16 | Ga0070679_100000068 | 3300005530 | Bacteria | 77184 |
| 17 | Ga0070684_100014993 | 3300005535 | Bacteria | 6295 |
| 18 | Ga0070684_100029524 | 3300005535 | Bacteria | 4648 |
| 19 | Ga0068853_100065396 | 3300005539 | Bacteria | 3156 |
| 20 | Ga0070665_100002351 | 3300005548 | Bacteria | 20915 |
| 21 | Ga0070665_100102918 | 3300005548 | Bacteria | 2859 |
| 22 | Ga0068855_100272665 | 3300005563 | Unclassified | 1881 |
| 23 | Ga0068854_100000095 | 3300005578 | Bacteria | 61892 |
| 24 | Ga0068854_100102305 | 3300005578 | Unclassified | 2149 |
| 25 | Ga0068852_100000093 | 3300005616 | Bacteria | 60834 |
| 26 | Ga0068851_10002379 | 3300005834 | Bacteria | 8265 |
| 27 | Ga0068851_10008802 | 3300005834 | Bacteria | 4677 |
| 28 | Ga0068863_100005074 | 3300005841 | Bacteria | 12987 |
| 29 | Ga0070715_10041963 | 3300006163 | Bacteria | 1920 |
| 30 | Ga0070712_100001375 | 3300006175 | Bacteria | 14754 |
| 31 | Ga0075431_100183910 | 3300006847 | Bacteria | 2144 |
| 32 | Ga0075433_10001323 | 3300006852 | Bacteria | 18133 |
| 33 | Ga0068865_100000592 | 3300006881 | Bacteria | 20337 |
| 34 | Ga0105245_10000266 | 3300009098 | Bacteria | 49944 |
| 35 | Ga0105247_10000628 | 3300009101 | Bacteria | 28197 |
| 36 | Ga0105242_10091007 | 3300009176 | Bacteria | 2568 |
| 37 | Ga0105248_10000008 | 3300009177 | Bacteria | 403910 |
| 38 | Ga0105238_10000011 | 3300009551 | Bacteria | 261080 |
| 39 | Ga0105249_10000203 | 3300009553 | Bacteria | 67783 |
| 40 | Ga0105239_10014255 | 3300010375 | Bacteria | 8825 |
| 41 | Ga0105239_10306339 | 3300010375 | Unclassified | 1789 |
| 42 | Ga0157371_10002088 | 3300013102 | Bacteria | 19521 |
| 43 | Ga0157370_10035926 | 3300013104 | Bacteria | 4812 |
| 44 | Ga0157369_10000020 | 3300013105 | Bacteria | 241679 |
| 45 | Ga0157378_10003549 | 3300013297 | Bacteria | 13820 |
| 46 | Ga0157378_10009501 | 3300013297 | Bacteria | 8468 |
| 47 | Ga0157378_10113139 | 3300013297 | Bacteria | 2491 |
| 48 | Ga0157372_10000112 | 3300013307 | Bacteria | 85902 |
| 49 | Ga0157379_10031153 | 3300014968 | Bacteria | 4751 |
| 50 | Ga0157376_10015575 | 3300014969 | Bacteria | 5748 |
| 51 | Ga0157376_10201748 | 3300014969 | Unclassified | 1830 |
| 52 | Ga0163161_10000357 | 3300017792 | Bacteria | 38514 |
| 53 | Ga0207656_10000834 | 3300025321 | Bacteria | 10065 |
| 54 | Ga0207656_10006160 | 3300025321 | Bacteria | 4296 |
| 55 | Ga0207710_10000239 | 3300025900 | Bacteria | 46663 |
| 56 | Ga0207685_10043751 | 3300025905 | Bacteria | 1689 |
| 57 | Ga0207693_10004139 | 3300025915 | Bacteria | 12313 |
| 58 | Ga0207649_10000009 | 3300025920 | Bacteria | 295544 |
| 59 | Ga0207652_10000044 | 3300025921 | Bacteria | 127779 |
| 60 | Ga0207694_10000004 | 3300025924 | Bacteria | 967075 |
| 61 | Ga0207687_10000007 | 3300025927 | Bacteria | 604185 |
| 62 | Ga0207700_10000027 | 3300025928 | Bacteria | 137708 |
| 63 | Ga0207690_10006715 | 3300025932 | Bacteria | 6817 |
| 64 | Ga0207686_10000718 | 3300025934 | Bacteria | 20545 |
| 65 | Ga0207686_10067855 | 3300025934 | Bacteria | 2283 |
| 66 | Ga0207670_10049178 | 3300025936 | Bacteria | 2819 |
| 67 | Ga0207704_10000157 | 3300025938 | Bacteria | 36439 |
| 68 | Ga0207711_10000006 | 3300025941 | Bacteria | 792692 |
| 69 | Ga0207661_10000139 | 3300025944 | Bacteria | 45892 |
| 70 | Ga0207667_10229986 | 3300025949 | Unclassified | 1899 |
| 71 | Ga0207712_10000007 | 3300025961 | Bacteria | 539589 |
| 72 | Ga0207640_10000038 | 3300025981 | Bacteria | 108630 |
| 73 | Ga0207640_10063357 | 3300025981 | Bacteria | 2457 |
| 74 | Ga0207658_10058877 | 3300025986 | Bacteria | 2861 |
| 75 | Ga0207677_10000340 | 3300026023 | Bacteria | 33455 |
| 76 | Ga0207678_10257260 | 3300026067 | Bacteria | 1496 |
| 77 | Ga0207641_10003641 | 3300026088 | Bacteria | 13588 |
| 78 | Ga0207698_10000013 | 3300026142 | Bacteria | 255414 |
| 79 | Ga0268266_10000640 | 3300028379 | Bacteria | 47545 |
| 80 | Ga0268266_10088813 | 3300028379 | Bacteria | 2705 |
| 81 | Ga0268265_10191364 | 3300028380 | Unclassified | 1767 |
| 82 | Ga0373937_0035582 | 3300036401 | Bacteria | 4534 |
| 83 | Ga0451807_2684618 | 3300041486 | Bacteria | 3832 |
| 84 | Ga0466957_0007287 | 3300044842 | Bacteria | 6251 |
| 85 | Ga0495629_0000381 | 3300046459 | Bacteria | 37177 |
| 86 | Ga0495629_0140087 | 3300046459 | Bacteria | 1683 |
| 87 | Ga0495641_0040858 | 3300046461 | Bacteria | 2156 |
| 88 | Ga0495662_0000019 | 3300046476 | Bacteria | 55148 |
| 89 | Ga0495662_0094151 | 3300046476 | Bacteria | 1463 |
| 90 | Ga0495608_0000125 | 3300046511 | Bacteria | 54881 |
| 91 | Ga0495608_0004591 | 3300046511 | Bacteria | 9859 |
| 92 | Ga0495608_0067687 | 3300046511 | Bacteria | 2336 |
| 93 | Ga0495628_0044849 | 3300046516 | Bacteria | 3516 |
| 94 | Ga0495628_0050838 | 3300046516 | Bacteria | 3278 |
| 95 | Ga0495630_0000020 | 3300046517 | Bacteria | 176389 |
| 96 | Ga0495630_0003550 | 3300046517 | Bacteria | 10861 |
| 97 | Ga0495652_0030781 | 3300046529 | Bacteria | 4703 |
| 98 | Ga0495640_0028648 | 3300046533 | Bacteria | 4007 |
| 99 | Ga0495586_0000161 | 3300046535 | Bacteria | 43544 |
| 100 | Ga0495587_0009351 | 3300046536 | Bacteria | 6284 |
| 101 | Ga0495645_0028577 | 3300046543 | Bacteria | 4053 |
| 102 | Ga0495667_0000018 | 3300046559 | Bacteria | 188610 |
| 103 | Ga0495634_0000561 | 3300046642 | Bacteria | 36353 |
| 104 | Ga0495635_0000044 | 3300046663 | Bacteria | 83945 |
| 105 | Ga0495588_0000340 | 3300046674 | Bacteria | 30427 |
| 106 | Ga0495657_0000004 | 3300046675 | Bacteria | 266465 |
| 107 | Ga0495657_0011598 | 3300046675 | Bacteria | 6585 |
| 108 | Ga0495647_0000018 | 3300046681 | Bacteria | 81701 |
| 109 | Ga0495647_0002412 | 3300046681 | Bacteria | 5889 |
| 110 | Ga0495669_0000033 | 3300046684 | Bacteria | 98629 |
| 111 | Ga0495613_0000179 | 3300046689 | Bacteria | 62109 |
| 112 | Ga0495624_0000073 | 3300046690 | Bacteria | 65582 |
| 113 | Ga0495624_0000097 | 3300046690 | Bacteria | 58715 |
| 114 | Ga0495649_0000751 | 3300046694 | Bacteria | 26125 |
| 115 | Ga0495604_0000137 | 3300047317 | Bacteria | 62542 |
| 116 | Ga0495674_0000064 | 3300047319 | Bacteria | 71275 |
| 117 | Ga0495676_0107182 | 3300047321 | Bacteria | 2057 |
| 118 | Ga0495680_0000496 | 3300047322 | Bacteria | 44440 |
| 119 | Ga0495680_0001082 | 3300047322 | Bacteria | 30201 |
| 120 | Ga0495680_0005380 | 3300047322 | Bacteria | 12069 |
| 121 | Ga0495675_0000175 | 3300047444 | Bacteria | 46609 |
| 122 | Ga0495593_0043160 | 3300047673 | Bacteria | 2418 |
| 123 | Ga0495593_0157357 | 3300047673 | Bacteria | 1148 |
| 124 | Ga0496100_0000002 | 3300048903 | Bacteria | 489057 |
| 125 | Ga0496101_0000001 | 3300048904 | Bacteria | 489057 |
| 126 | Ga0496102_0000039 | 3300048905 | Bacteria | 198306 |
| 127 | Ga0496102_0008087 | 3300048905 | Bacteria | 8997 |
| 128 | Ga0496103_0000008 | 3300048906 | Bacteria | 340474 |
| 129 | Ga0496104_0000004 | 3300048907 | Bacteria | 641830 |
| 130 | Ga0496104_0000009 | 3300048907 | Bacteria | 488055 |
| 131 | Ga0496105_0000001 | 3300048908 | Bacteria | 1328178 |
| 132 | Ga0496105_0000007 | 3300048908 | Bacteria | 339658 |
| 133 | Ga0496106_0000110 | 3300048909 | Bacteria | 63946 |
| 134 | Ga0496107_0000003 | 3300048910 | Bacteria | 304038 |
| 135 | Ga0496109_0000121 | 3300048912 | Bacteria | 81487 |
| 136 | Ga0496109_0000568 | 3300048912 | Bacteria | 30898 |
| 137 | Ga0496110_0000388 | 3300048913 | Bacteria | 29649 |
| 138 | Ga0496110_0019958 | 3300048913 | Bacteria | 5650 |
| 139 | Ga0496110_0032745 | 3300048913 | Bacteria | 4493 |
| 140 | Ga0496111_0000019 | 3300048914 | Bacteria | 68278 |
| 141 | Ga0496112_0001972 | 3300048915 | Bacteria | 16214 |
| 142 | Ga0496112_0238715 | 3300048915 | Bacteria | 1771 |
| 143 | Ga0496113_0000073 | 3300048916 | Bacteria | 44302 |
| 144 | Ga0496113_0046203 | 3300048916 | Bacteria | 3232 |
| 145 | Ga0496114_0251304 | 3300048917 | Unclassified | 1556 |
| 146 | Ga0496117_0001757 | 3300048920 | Bacteria | 29817 |
| 147 | Ga0496118_0000550 | 3300048921 | Bacteria | 61734 |
| 148 | Ga0496119_0017993 | 3300048922 | Bacteria | 5285 |
| 149 | nmdc:mga06r32_76600_c1 | 3300050510 | Bacteria | 3248 |
| 150 | nmdc:mga0a205_1451_c1 | 3300050515 | Bacteria | 20201 |
| 151 | Ga0495601_0000013 | 3300053077 | Bacteria | 226476 |
| 152 | Ga0495601_0000364 | 3300053077 | Bacteria | 23907 |
| 153 | Ga0495612_0000060 | 3300053078 | Bacteria | 49047 |
| 154 | Ga0495612_0048094 | 3300053078 | Bacteria | 1748 |
| 155 | Ga0495655_0009284 | 3300053083 | Bacteria | 1901 |
| 156 | Ga0495595_0000003 | 3300053084 | Bacteria | 266465 |
| 157 | Ga0495595_0000053 | 3300053084 | Bacteria | 59851 |
| 158 | Ga0495619_0000031 | 3300053085 | Bacteria | 145508 |
| 159 | Ga0495619_0000116 | 3300053085 | Bacteria | 58748 |
| 160 | Ga0495619_0054987 | 3300053085 | Bacteria | 2636 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009177 | Ga0105248_10000008 | Ga0105248_10000008324 | 307 |
| 2 | 3300013102 | Ga0157371_10002088 | Ga0157371_100020882 | 308 |
| 3 | 3300046461 | Ga0495641_0040858 | Ga0495641_0040858_869_1798 | 308 |
| 4 | 3300046543 | Ga0495645_0028577 | Ga0495645_0028577_1414_2361 | 315 |
| 5 | 3300048915 | Ga0496112_0238715 | Ga0496112_0238715_236_1270 | 317 |
| 6 | 3300005365 | Ga0070688_100000208 | Ga0070688_10000020821 | 322 |
| 7 | 3300005466 | Ga0070685_10000178 | Ga0070685_1000017829 | 322 |
| 8 | 3300009098 | Ga0105245_10000266 | Ga0105245_1000026612 | 322 |
| 9 | 3300025927 | Ga0207687_10000007 | Ga0207687_10000007416 | 322 |
| 10 | 3300005329 | Ga0070683_100002880 | Ga0070683_1000028806 | 323 |
| 11 | 3300013297 | Ga0157378_10003549 | Ga0157378_100035496 | 323 |
| 12 | 3300025944 | Ga0207661_10000139 | Ga0207661_1000013927 | 323 |
| 13 | 3300005841 | Ga0068863_100005074 | Ga0068863_1000050745 | 324 |
| 14 | 3300026088 | Ga0207641_10003641 | Ga0207641_100036417 | 324 |
| 15 | 3300048905 | Ga0496102_0000039 | Ga0496102_0000039_67790_68881 | 324 |
| 16 | 3300048906 | Ga0496103_0000008 | Ga0496103_0000008_189045_190136 | 324 |
| 17 | 3300013105 | Ga0157369_10000020 | Ga0157369_10000020208 | 325 |
| 18 | 3300010375 | Ga0105239_10306339 | Ga0105239_103063392 | 326 |
| 19 | 3300014969 | Ga0157376_10201748 | Ga0157376_102017482 | 327 |
| 20 | 3300048907 | Ga0496104_0000009 | Ga0496104_0000009_240273_241328 | 328 |
| 21 | 3300048908 | Ga0496105_0000007 | Ga0496105_0000007_246728_247783 | 328 |
| 22 | 3300028380 | Ga0268265_10191364 | Ga0268265_101913642 | 330 |
| 23 | 3300047319 | Ga0495674_0000064 | Ga0495674_0000064_16858_17952 | 332 |
| 24 | 3300005539 | Ga0068853_100065396 | Ga0068853_1000653963 | 334 |
| 25 | 3300013104 | Ga0157370_10035926 | Ga0157370_100359264 | 334 |
| 26 | 3300044842 | Ga0466957_0007287 | Ga0466957_0007287_4526_5623 | 334 |
| 27 | 3300005335 | Ga0070666_10025245 | Ga0070666_100252453 | 335 |
| 28 | 3300005563 | Ga0068855_100272665 | Ga0068855_1002726652 | 335 |
| 29 | 3300025949 | Ga0207667_10229986 | Ga0207667_102299861 | 335 |
| 30 | 3300025986 | Ga0207658_10058877 | Ga0207658_100588772 | 335 |
| 31 | 3300046476 | Ga0495662_0000019 | Ga0495662_0000019_1375_2469 | 335 |
| 32 | 3300005337 | Ga0070682_100000117 | Ga0070682_1000001179 | 336 |
| 33 | 3300006163 | Ga0070715_10041963 | Ga0070715_100419632 | 336 |
| 34 | 3300025905 | Ga0207685_10043751 | Ga0207685_100437512 | 336 |
| 35 | 3300046559 | Ga0495667_0000018 | Ga0495667_0000018_113947_115035 | 336 |
| 36 | 3300047322 | Ga0495680_0005380 | Ga0495680_0005380_2640_3728 | 336 |
| 37 | 3300050515 | nmdc:mga0a205_1451_c1 | nmdc:mga0a205_1451_c1_2784_3797 | 336 |
| 38 | 3300053085 | Ga0495619_0000031 | Ga0495619_0000031_139055_140149 | 336 |
| 39 | 3300006881 | Ga0068865_100000592 | Ga0068865_1000005923 | 337 |
| 40 | 3300025938 | Ga0207704_10000157 | Ga0207704_1000015729 | 337 |
| 41 | 3300048915 | Ga0496112_0001972 | Ga0496112_0001972_10225_11319 | 337 |
| 42 | 3300048916 | Ga0496113_0000073 | Ga0496113_0000073_27443_28537 | 337 |
| 43 | 3300046642 | Ga0495634_0000561 | Ga0495634_0000561_32104_33195 | 338 |
| 44 | 3300047321 | Ga0495676_0107182 | Ga0495676_0107182_56_1138 | 338 |
| 45 | 3300048903 | Ga0496100_0000002 | Ga0496100_0000002_351388_352443 | 338 |
| 46 | 3300048904 | Ga0496101_0000001 | Ga0496101_0000001_351388_352443 | 338 |
| 47 | 3300048909 | Ga0496106_0000110 | Ga0496106_0000110_158_1213 | 338 |
| 48 | 3300048910 | Ga0496107_0000003 | Ga0496107_0000003_131_1186 | 338 |
| 49 | 3300048913 | Ga0496110_0000388 | Ga0496110_0000388_2245_3339 | 338 |
| 50 | 3300048914 | Ga0496111_0000019 | Ga0496111_0000019_26321_27415 | 338 |
| 51 | 3300005535 | Ga0070684_100014993 | Ga0070684_1000149932 | 339 |
| 52 | 3300046516 | Ga0495628_0050838 | Ga0495628_0050838_1412_2470 | 339 |
| 53 | 3300013307 | Ga0157372_10000112 | Ga0157372_1000011269 | 340 |
| 54 | 3300010375 | Ga0105239_10014255 | Ga0105239_100142557 | 341 |
| 55 | 3300047673 | Ga0495593_0043160 | Ga0495593_0043160_203_1288 | 341 |
| 56 | 3300047673 | Ga0495593_0157357 | Ga0495593_0157357_14_1072 | 341 |
| 57 | 3300025961 | Ga0207712_10000007 | Ga0207712_10000007363 | 342 |
| 58 | 3300005366 | Ga0070659_100021766 | Ga0070659_1000217662 | 344 |
| 59 | 3300025932 | Ga0207690_10006715 | Ga0207690_100067155 | 344 |
| 60 | 3300046535 | Ga0495586_0000161 | Ga0495586_0000161_36946_38130 | 344 |
| 61 | 3300005834 | Ga0068851_10002379 | Ga0068851_100023796 | 345 |
| 62 | 3300006175 | Ga0070712_100001375 | Ga0070712_1000013752 | 345 |
| 63 | 3300025321 | Ga0207656_10000834 | Ga0207656_100008345 | 345 |
| 64 | 3300025915 | Ga0207693_10004139 | Ga0207693_100041392 | 345 |
| 65 | 3300028379 | Ga0268266_10088813 | Ga0268266_100888132 | 345 |
| 66 | 3300005578 | Ga0068854_100102305 | Ga0068854_1001023051 | 346 |
| 67 | 3300009176 | Ga0105242_10091007 | Ga0105242_100910072 | 346 |
| 68 | 3300025934 | Ga0207686_10067855 | Ga0207686_100678552 | 346 |
| 69 | 3300025981 | Ga0207640_10063357 | Ga0207640_100633572 | 346 |
| 70 | 3300046684 | Ga0495669_0000033 | Ga0495669_0000033_15853_16905 | 346 |
| 71 | 3300046690 | Ga0495624_0000097 | Ga0495624_0000097_9822_10871 | 346 |
| 72 | 3300047322 | Ga0495680_0001082 | Ga0495680_0001082_2281_3375 | 346 |
| 73 | 3300005365 | Ga0070688_100000256 | Ga0070688_10000025618 | 347 |
| 74 | 3300005458 | Ga0070681_10010667 | Ga0070681_100106678 | 347 |
| 75 | 3300005466 | Ga0070685_10000355 | Ga0070685_1000035518 | 347 |
| 76 | 3300005530 | Ga0070679_100000068 | Ga0070679_10000006839 | 347 |
| 77 | 3300025921 | Ga0207652_10000044 | Ga0207652_1000004442 | 347 |
| 78 | 3300046536 | Ga0495587_0009351 | Ga0495587_0009351_1352_2455 | 347 |
| 79 | 3300046681 | Ga0495647_0000018 | Ga0495647_0000018_28214_29269 | 347 |
| 80 | 3300047322 | Ga0495680_0000496 | Ga0495680_0000496_21988_23043 | 347 |
| 81 | 3300005338 | Ga0068868_100000541 | Ga0068868_1000005418 | 348 |
| 82 | 3300005548 | Ga0070665_100102918 | Ga0070665_1001029182 | 348 |
| 83 | 3300026023 | Ga0207677_10000340 | Ga0207677_1000034014 | 348 |
| 84 | 3300036401 | Ga0373937_0035582 | Ga0373937_0035582_108_1166 | 348 |
| 85 | 3300046694 | Ga0495649_0000751 | Ga0495649_0000751_14981_16039 | 348 |
| 86 | 3300005548 | Ga0070665_100002351 | Ga0070665_1000023513 | 349 |
| 87 | 3300028379 | Ga0268266_10000640 | Ga0268266_1000064027 | 349 |
| 88 | 3300046516 | Ga0495628_0044849 | Ga0495628_0044849_454_1542 | 349 |
| 89 | 3300046529 | Ga0495652_0030781 | Ga0495652_0030781_3596_4684 | 349 |
| 90 | 3300046681 | Ga0495647_0002412 | Ga0495647_0002412_3927_4985 | 349 |
| 91 | 3300046517 | Ga0495630_0000020 | Ga0495630_0000020_31238_32299 | 350 |
| 92 | 3300009551 | Ga0105238_10000011 | Ga0105238_10000011175 | 351 |
| 93 | 3300025924 | Ga0207694_10000004 | Ga0207694_10000004447 | 351 |
| 94 | 3300048907 | Ga0496104_0000004 | Ga0496104_0000004_305823_306953 | 351 |
| 95 | 3300048908 | Ga0496105_0000001 | Ga0496105_0000001_334878_336008 | 351 |
| 96 | 3300048922 | Ga0496119_0017993 | Ga0496119_0017993_1118_2248 | 351 |
| 97 | 3300009553 | Ga0105249_10000203 | Ga0105249_1000020324 | 352 |
| 98 | 3300014968 | Ga0157379_10031153 | Ga0157379_100311533 | 352 |
| 99 | 3300026067 | Ga0207678_10257260 | Ga0207678_102572601 | 352 |
| 100 | 3300046476 | Ga0495662_0094151 | Ga0495662_0094151_100_1242 | 352 |
| 101 | 3300048905 | Ga0496102_0008087 | Ga0496102_0008087_1329_2396 | 352 |
| 102 | 3300048912 | Ga0496109_0000121 | Ga0496109_0000121_26462_27565 | 352 |
| 103 | 3300048913 | Ga0496110_0032745 | Ga0496110_0032745_1199_2326 | 352 |
| 104 | 3300048916 | Ga0496113_0046203 | Ga0496113_0046203_666_1739 | 352 |
| 105 | 3300048920 | Ga0496117_0001757 | Ga0496117_0001757_17084_18151 | 352 |
| 106 | 3300048921 | Ga0496118_0000550 | Ga0496118_0000550_47960_49027 | 352 |
| 107 | 3300050510 | nmdc:mga06r32_76600_c1 | nmdc:mga06r32_76600_c1_1588_2715 | 352 |
| 108 | 3300014969 | Ga0157376_10015575 | Ga0157376_100155753 | 353 |
| 109 | 3300048912 | Ga0496109_0000568 | Ga0496109_0000568_29430_30503 | 353 |
| 110 | 3300005436 | Ga0070713_100000186 | Ga0070713_10000018627 | 354 |
| 111 | 3300005616 | Ga0068852_100000093 | Ga0068852_10000009346 | 354 |
| 112 | 3300005834 | Ga0068851_10008802 | Ga0068851_100088022 | 354 |
| 113 | 3300013297 | Ga0157378_10113139 | Ga0157378_101131391 | 354 |
| 114 | 3300025321 | Ga0207656_10006160 | Ga0207656_100061603 | 354 |
| 115 | 3300025928 | Ga0207700_10000027 | Ga0207700_1000002770 | 354 |
| 116 | 3300025936 | Ga0207670_10049178 | Ga0207670_100491782 | 354 |
| 117 | 3300025941 | Ga0207711_10000006 | Ga0207711_10000006718 | 354 |
| 118 | 3300026142 | Ga0207698_10000013 | Ga0207698_1000001324 | 354 |
| 119 | 3300046674 | Ga0495588_0000340 | Ga0495588_0000340_7075_8184 | 354 |
| 120 | 3300047317 | Ga0495604_0000137 | Ga0495604_0000137_30229_31323 | 354 |
| 121 | 3300013297 | Ga0157378_10009501 | Ga0157378_100095015 | 355 |
| 122 | 3300046511 | Ga0495608_0067687 | Ga0495608_0067687_810_1901 | 355 |
| 123 | 3300046690 | Ga0495624_0000073 | Ga0495624_0000073_5517_6671 | 355 |
| 124 | 3300053078 | Ga0495612_0000060 | Ga0495612_0000060_37905_38996 | 355 |
| 125 | 3300053083 | Ga0495655_0009284 | Ga0495655_0009284_163_1254 | 355 |
| 126 | 3300053085 | Ga0495619_0054987 | Ga0495619_0054987_97_1188 | 355 |
| 127 | 3300005344 | Ga0070661_100000344 | Ga0070661_1000003444 | 356 |
| 128 | 3300005578 | Ga0068854_100000095 | Ga0068854_10000009539 | 356 |
| 129 | 3300025920 | Ga0207649_10000009 | Ga0207649_10000009253 | 356 |
| 130 | 3300025981 | Ga0207640_10000038 | Ga0207640_1000003873 | 356 |
| 131 | 3300046511 | Ga0495608_0000125 | Ga0495608_0000125_31139_32236 | 356 |
| 132 | 3300046675 | Ga0495657_0000004 | Ga0495657_0000004_154560_155657 | 356 |
| 133 | 3300046689 | Ga0495613_0000179 | Ga0495613_0000179_54986_56086 | 356 |
| 134 | 3300047444 | Ga0495675_0000175 | Ga0495675_0000175_5631_6728 | 356 |
| 135 | 3300053077 | Ga0495601_0000013 | Ga0495601_0000013_52233_53333 | 356 |
| 136 | 3300053084 | Ga0495595_0000003 | Ga0495595_0000003_154560_155657 | 356 |
| 137 | 3300053085 | Ga0495619_0000116 | Ga0495619_0000116_1327_2424 | 356 |
| 138 | 3300006852 | Ga0075433_10001323 | Ga0075433_1000132311 | 357 |
| 139 | 3300041486 | Ga0451807_2684618 | Ga0451807_2684618_2383_3519 | 357 |
| 140 | 3300046459 | Ga0495629_0000381 | Ga0495629_0000381_29848_30948 | 358 |
| 141 | 3300046517 | Ga0495630_0003550 | Ga0495630_0003550_7369_8469 | 358 |
| 142 | 3300046675 | Ga0495657_0011598 | Ga0495657_0011598_3678_4778 | 358 |
| 143 | 3300048913 | Ga0496110_0019958 | Ga0496110_0019958_1240_2340 | 358 |
| 144 | 3300048917 | Ga0496114_0251304 | Ga0496114_0251304_236_1336 | 358 |
| 145 | 3300053077 | Ga0495601_0000364 | Ga0495601_0000364_19465_20565 | 358 |
| 146 | 3300053078 | Ga0495612_0048094 | Ga0495612_0048094_632_1732 | 358 |
| 147 | 3300006847 | Ga0075431_100183910 | Ga0075431_1001839102 | 359 |
| 148 | 3300048913 | Ga0496110_0032745 | Ga0496110_0032745_2452_3609 | 359 |
| 149 | 3300005364 | Ga0070673_100017407 | Ga0070673_1000174074 | 360 |
| 150 | 3300046459 | Ga0495629_0140087 | Ga0495629_0140087_184_1272 | 360 |
| 151 | 3300017792 | Ga0163161_10000357 | Ga0163161_1000035732 | 361 |
| 152 | 3300046511 | Ga0495608_0004591 | Ga0495608_0004591_5287_6381 | 361 |
| 153 | 3300046533 | Ga0495640_0028648 | Ga0495640_0028648_2611_3705 | 361 |
| 154 | 3300046663 | Ga0495635_0000044 | Ga0495635_0000044_28480_29574 | 361 |
| 155 | 3300053084 | Ga0495595_0000053 | Ga0495595_0000053_44306_45400 | 361 |
| 156 | 3300009101 | Ga0105247_10000628 | Ga0105247_1000062818 | 363 |
| 157 | 3300025900 | Ga0207710_10000239 | Ga0207710_1000023926 | 363 |
| 158 | 3300005535 | Ga0070684_100029524 | Ga0070684_1000295244 | 369 |
| 159 | 3300005329 | Ga0070683_100029624 | Ga0070683_1000296242 | 373 |
| 160 | 3300025934 | Ga0207686_10000718 | Ga0207686_100007185 | 377 |
| 161 | 3300001979 | JGI24740J21852_10003385 | JGI24740J21852_100033855 | 378 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2cip-assembly1.cif.gz_A | structure of the michaelis complex of a family 26 lichenase | 0.91 | 42 | 341 |
| 2cip-assembly1.cif.gz_A | structure of the michaelis complex of a family 26 lichenase | 0.9068 | 42 | 341 |
| 2vi0-assembly1.cif.gz_A | lichenase ctlic26 in complex with a thio-oligosaccharide | 0.9063 | 44 | 341 |
| 2v3g-assembly1.cif.gz_A | structure of a family 26 lichenase in complex with noeuromycin | 0.9017 | 44 | 339 |
| 2vi0-assembly1.cif.gz_A | lichenase ctlic26 in complex with a thio-oligosaccharide | 0.8999 | 44 | 341 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2cipA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.91 | 42 | 341 | 3.20.20.80 |
| 2cipA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.9068 | 42 | 341 | 3.20.20.80 |
| 4yn5A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.7359 | 43 | 357 | 3.20.20.80 |
| 3zm8A02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.7052 | 43 | 349 | 3.20.20.80 |
| 6hpfA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.6847 | 43 | 347 | 3.20.20.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A067LZ12-F1-model_v4 | deleted | 0.943 | 44 | 340 |
|
| AF-A0A810MFD9-F1-model_v4 | deleted | 0.941 | 227 | 343 |
|
| AF-A0A399RFR0-F1-model_v4 | Beta-mannanase | 0.932 | 42 | 340 |
GO:0006080
GO:0016985 |
| AF-A0JT99-F1-model_v4 | Beta-mannanase-like protein | 0.929 | 42 | 340 |
GO:0006080
GO:0016985 |
| AF-A0A661KV64-F1-model_v4 | GH26 domain-containing protein | 0.9275 | 195 | 344 |
GO:0006080
GO:0016985 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar