F236536

General Info

Members Datasets Scaffolds Average Seq Length
161 117 322 74

Family's Representative Sequence

Representative Sequence 3300005615|Ga0070702_100002707|Ga0070702_1000027075
Length 85
Sequence VFDLQVSKMFRMNARNVVHSDPEIMSGTPVFVGTRVPVHNLFDYLEAGDSLEKFLASFPSVSREQAIAALELAKEAVVEVASAHR

Samples

Sample ID Description Type Environment
1 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
62 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
83 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
85 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
86 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
87 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
88 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
89 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
90 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
93 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
96 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
97 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
98 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
99 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
100 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
101 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
102 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
103 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
104 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
105 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
106 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
107 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
108 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
110 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
111 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
112 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
113 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
114 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
115 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
116 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
117 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.38
Metatranscriptomes 0.62
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.62
Nodule 0
Rhizoplane 0
Rhizosphere 97.52
Stem 0
Stem Tuber 0
Unclassified 32.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070702_100002707 3300005615 Bacteria 7744
2 Ga0070676_10521605 3300005328 Unclassified 846
3 Ga0070683_100000065 3300005329 Bacteria 74402
4 Ga0070690_100813696 3300005330 Bacteria 725
5 Ga0070682_100238249 3300005337 Bacteria 1305
6 Ga0068868_100000072 3300005338 Bacteria 59008
7 Ga0068868_101788470 3300005338 Unclassified 580
8 Ga0070689_100001508 3300005340 Bacteria 14849
9 Ga0070689_100341572 3300005340 Bacteria 1254
10 Ga0070661_100640241 3300005344 Unclassified 862
11 Ga0070692_10022879 3300005345 Bacteria 3058
12 Ga0070692_10235563 3300005345 Bacteria 1089
13 Ga0070675_101579228 3300005354 Unclassified 605
14 Ga0070674_100558820 3300005356 Unclassified 961
15 Ga0070659_100440891 3300005366 Unclassified 1103
16 Ga0070714_100048124 3300005435 Bacteria 3625
17 Ga0070710_10322326 3300005437 Bacteria 1015
18 Ga0070705_101668697 3300005440 Unclassified 538
19 Ga0070705_101842561 3300005440 Unclassified 514
20 Ga0070685_10002994 3300005466 Bacteria 8628
21 Ga0070685_10031684 3300005466 Bacteria 2956
22 Ga0070707_100024744 3300005468 Bacteria 5691
23 Ga0070707_100085827 3300005468 Bacteria 3043
24 Ga0070699_100068830 3300005518 Bacteria 3075
25 Ga0070684_100005077 3300005535 Bacteria 10052
26 Ga0070684_100213130 3300005535 Bacteria 1760
27 Ga0070697_101771957 3300005536 Unclassified 552
28 Ga0068853_100399846 3300005539 Bacteria 1286
29 Ga0070672_100000910 3300005543 Bacteria 17716
30 Ga0070686_100254585 3300005544 Bacteria 1284
31 Ga0070695_101412225 3300005545 Unclassified 577
32 Ga0070696_100056988 3300005546 Bacteria 2726
33 Ga0070693_100659810 3300005547 Unclassified 762
34 Ga0068859_100019243 3300005617 Bacteria 6859
35 Ga0068859_101265450 3300005617 Bacteria 813
36 Ga0068858_100000296 3300005842 Bacteria 53555
37 Ga0068858_100330003 3300005842 Bacteria 1459
38 Ga0068858_100413066 3300005842 Bacteria 1297
39 Ga0068862_101696289 3300005844 Unclassified 640
40 Ga0070717_10084762 3300006028 Bacteria 2666
41 Ga0070716_100376108 3300006173 Bacteria 1014
42 Ga0097621_100185821 3300006237 Bacteria 1798
43 Ga0075428_100429312 3300006844 Bacteria 1416
44 Ga0075430_100011954 3300006846 Bacteria 7392
45 Ga0075430_100505854 3300006846 Bacteria 997
46 Ga0075431_100005567 3300006847 Bacteria 12437
47 Ga0075431_100329724 3300006847 Bacteria 1537
48 Ga0075433_10378356 3300006852 Bacteria 1250
49 Ga0075433_10572422 3300006852 Bacteria 992
50 Ga0075434_101160190 3300006871 Unclassified 785
51 Ga0075434_101859260 3300006871 Bacteria 608
52 Ga0075429_100198282 3300006880 Bacteria 1758
53 Ga0075429_100308564 3300006880 Bacteria 1385
54 Ga0075436_100623825 3300006914 Unclassified 795
55 Ga0097620_100019245 3300006931 Bacteria 6859
56 Ga0097620_101265472 3300006931 Bacteria 813
57 Ga0075435_100123353 3300007076 Bacteria 2163
58 Ga0111539_10316282 3300009094 Bacteria 1817
59 Ga0111539_11200958 3300009094 Unclassified 881
60 Ga0111539_12985801 3300009094 Unclassified 547
61 Ga0105245_10025785 3300009098 Bacteria 5170
62 Ga0105245_10742098 3300009098 Bacteria 1017
63 Ga0114129_10564490 3300009147 Unclassified 1478
64 Ga0114129_13049076 3300009147 Unclassified 549
65 Ga0105242_11876663 3300009176 Unclassified 639
66 Ga0105248_13177674 3300009177 Unclassified 523
67 Ga0105237_11526824 3300009545 Bacteria 675
68 Ga0105238_10000001 3300009551 Bacteria 2036163
69 Ga0105239_10358764 3300010375 Bacteria 1646
70 Ga0105246_10142262 3300011119 Bacteria 1805
71 Ga0105246_11946685 3300011119 Unclassified 566
72 Ga0157370_10806317 3300013104 Bacteria 854
73 Ga0157369_10001441 3300013105 Bacteria 29206
74 Ga0157374_10000012 3300013296 Bacteria 462353
75 Ga0157374_12881121 3300013296 Unclassified 508
76 Ga0157378_10013364 3300013297 Bacteria 7175
77 Ga0157378_10109276 3300013297 Unclassified 2533
78 Ga0157378_10647923 3300013297 Bacteria 1072
79 Ga0157378_10817449 3300013297 Unclassified 958
80 Ga0163162_10340220 3300013306 Bacteria 1633
81 Ga0163162_10759383 3300013306 Bacteria 1089
82 Ga0157375_10000001 3300013308 Bacteria 696576
83 Ga0157375_10000089 3300013308 Bacteria 92109
84 Ga0157375_10000106 3300013308 Bacteria 82080
85 Ga0163163_10254012 3300014325 Bacteria 1808
86 Ga0157380_10017813 3300014326 Bacteria 5263
87 Ga0157380_11169988 3300014326 Bacteria 811
88 Ga0157377_10000002 3300014745 Bacteria 473827
89 Ga0157377_10409020 3300014745 Unclassified 926
90 Ga0157379_11669727 3300014968 Bacteria 623
91 Ga0213876_10053527 3300021384 Bacteria 2131
92 Ga0224712_10671836 3300022467 Archaea 509
93 Ga0207692_10241040 3300025898 Bacteria 1080
94 Ga0207699_10142821 3300025906 Bacteria 1575
95 Ga0207705_10336914 3300025909 Bacteria 1161
96 Ga0207649_10788981 3300025920 Unclassified 741
97 Ga0207646_10003517 3300025922 Bacteria 17649
98 Ga0207646_10061024 3300025922 Bacteria 3366
99 Ga0207694_10000001 3300025924 Bacteria 4078485
100 Ga0207650_10370756 3300025925 Bacteria 1181
101 Ga0207650_10429792 3300025925 Bacteria 1097
102 Ga0207687_10010979 3300025927 Bacteria 5918
103 Ga0207700_10506802 3300025928 Unclassified 1068
104 Ga0207664_10151831 3300025929 Bacteria 1968
105 Ga0207690_11576601 3300025932 Unclassified 549
106 Ga0207670_10000643 3300025936 Bacteria 18596
107 Ga0207670_10070162 3300025936 Bacteria 2419
108 Ga0207669_10495840 3300025937 Unclassified 976
109 Ga0207704_10595560 3300025938 Bacteria 904
110 Ga0207691_10028501 3300025940 Bacteria 5229
111 Ga0207661_10000044 3300025944 Bacteria 115753
112 Ga0207712_11132183 3300025961 Unclassified 697
113 Ga0207677_10000009 3300026023 Bacteria 252751
114 Ga0207703_10000046 3300026035 Bacteria 154474
115 Ga0207703_11511890 3300026035 Unclassified 646
116 Ga0207428_10232982 3300027907 Bacteria 1377
117 Ga0268265_11260801 3300028380 Unclassified 738
118 Ga0265319_1098594 3300028563 Bacteria 918
119 Ga0307511_10101165 3300030521 Bacteria 1891
120 Ga0265327_10000929 3300031251 Bacteria 42900
121 Ga0265327_10281512 3300031251 Bacteria 735
122 Ga0265316_10001426 3300031344 Bacteria 25713
123 Ga0307405_11418883 3300031731 Bacteria 608
124 Ga0307406_10411292 3300031901 Unclassified 1075
125 Ga0307416_101038017 3300032002 Bacteria 923
126 Ga0307415_100035347 3300032126 Bacteria 3263
127 Ga0373938_0125496 3300034957 Bacteria 665
128 Ga0373943_0111599 3300035170 Bacteria 1443
129 Ga0373943_0736810 3300035170 Unclassified 585
130 Ga0373937_0402250 3300036401 Bacteria 1299
131 Ga0373937_0778850 3300036401 Bacteria 904
132 Ga0436365_1379372 3300039437 Bacteria 14387
133 Ga0439435_0051346 3300042436 Unclassified 1181
134 Ga0439435_0235861 3300042436 Unclassified 612
135 Ga0451577_1289713 3300042876 Unclassified 650
136 Ga0495638_0037046 3300046460 Unclassified 3104
137 Ga0495653_0757320 3300046463 Unclassified 586
138 Ga0495662_0477499 3300046476 Unclassified 611
139 Ga0495620_0002807 3300046515 Bacteria 10015
140 Ga0495630_0508886 3300046517 Unclassified 923
141 Ga0495635_0037187 3300046663 Unclassified 3370
142 Ga0495624_0230186 3300046690 Bacteria 1123
143 Ga0495600_0013570 3300046809 Bacteria 5123
144 Ga0495581_0170240 3300047315 Bacteria 1274
145 Ga0495581_0770902 3300047315 Unclassified 553
146 Ga0495680_0054406 3300047322 Unclassified 3108
147 Ga0501039_1325199 3300049575 Unclassified 555
148 Ga0501073_0744813 3300049589 Bacteria 676
149 nmdc:mga05p37_1009830_c1 3300050507 Unclassified 883
150 nmdc:mga09592_110809_c1 3300050508 Bacteria 2355
151 nmdc:mga09592_378675_c1 3300050508 Bacteria 1224
152 nmdc:mga0qj67_668_c1 3300050509 Bacteria 23474
153 nmdc:mga06r32_118196_c1 3300050510 Bacteria 2613
154 nmdc:mga06r32_1497_c1 3300050510 Bacteria 21014
155 nmdc:mga08y16_281872_c1 3300050511 Unclassified 1714
156 nmdc:mga08y16_48233_c1 3300050511 Bacteria 4457
157 nmdc:mga0n895_1230782_c1 3300050512 Unclassified 722
158 nmdc:mga0n895_1692809_c1 3300050512 Unclassified 595
159 nmdc:mga08x19_405157_c1 3300050514 Unclassified 957
160 nmdc:mga08x19_788289_c1 3300050514 Unclassified 675
161 Ga0500592_041990 3300053116 Unclassified 741
162 Ga0070702_100002707
163 Ga0070676_10521605
164 Ga0070683_100000065
165 Ga0070690_100813696
166 Ga0070682_100238249
167 Ga0068868_100000072
168 Ga0068868_101788470
169 Ga0070689_100001508
170 Ga0070689_100341572
171 Ga0070661_100640241
172 Ga0070692_10022879
173 Ga0070692_10235563
174 Ga0070675_101579228
175 Ga0070674_100558820
176 Ga0070659_100440891
177 Ga0070714_100048124
178 Ga0070710_10322326
179 Ga0070705_101668697
180 Ga0070705_101842561
181 Ga0070685_10002994
182 Ga0070685_10031684
183 Ga0070707_100024744
184 Ga0070707_100085827
185 Ga0070699_100068830
186 Ga0070684_100005077
187 Ga0070684_100213130
188 Ga0070697_101771957
189 Ga0068853_100399846
190 Ga0070672_100000910
191 Ga0070686_100254585
192 Ga0070695_101412225
193 Ga0070696_100056988
194 Ga0070693_100659810
195 Ga0068859_100019243
196 Ga0068859_101265450
197 Ga0068858_100000296
198 Ga0068858_100330003
199 Ga0068858_100413066
200 Ga0068862_101696289
201 Ga0070717_10084762
202 Ga0070716_100376108
203 Ga0097621_100185821
204 Ga0075428_100429312
205 Ga0075430_100011954
206 Ga0075430_100505854
207 Ga0075431_100005567
208 Ga0075431_100329724
209 Ga0075433_10378356
210 Ga0075433_10572422
211 Ga0075434_101160190
212 Ga0075434_101859260
213 Ga0075429_100198282
214 Ga0075429_100308564
215 Ga0075436_100623825
216 Ga0097620_100019245
217 Ga0097620_101265472
218 Ga0075435_100123353
219 Ga0111539_10316282
220 Ga0111539_11200958
221 Ga0111539_12985801
222 Ga0105245_10025785
223 Ga0105245_10742098
224 Ga0114129_10564490
225 Ga0114129_13049076
226 Ga0105242_11876663
227 Ga0105248_13177674
228 Ga0105237_11526824
229 Ga0105238_10000001
230 Ga0105239_10358764
231 Ga0105246_10142262
232 Ga0105246_11946685
233 Ga0157370_10806317
234 Ga0157369_10001441
235 Ga0157374_10000012
236 Ga0157374_12881121
237 Ga0157378_10013364
238 Ga0157378_10109276
239 Ga0157378_10647923
240 Ga0157378_10817449
241 Ga0163162_10340220
242 Ga0163162_10759383
243 Ga0157375_10000001
244 Ga0157375_10000089
245 Ga0157375_10000106
246 Ga0163163_10254012
247 Ga0157380_10017813
248 Ga0157380_11169988
249 Ga0157377_10000002
250 Ga0157377_10409020
251 Ga0157379_11669727
252 Ga0213876_10053527
253 Ga0224712_10671836
254 Ga0207692_10241040
255 Ga0207699_10142821
256 Ga0207705_10336914
257 Ga0207649_10788981
258 Ga0207646_10003517
259 Ga0207646_10061024
260 Ga0207694_10000001
261 Ga0207650_10370756
262 Ga0207650_10429792
263 Ga0207687_10010979
264 Ga0207700_10506802
265 Ga0207664_10151831
266 Ga0207690_11576601
267 Ga0207670_10000643
268 Ga0207670_10070162
269 Ga0207669_10495840
270 Ga0207704_10595560
271 Ga0207691_10028501
272 Ga0207661_10000044
273 Ga0207712_11132183
274 Ga0207677_10000009
275 Ga0207703_10000046
276 Ga0207703_11511890
277 Ga0207428_10232982
278 Ga0268265_11260801
279 Ga0265319_1098594
280 Ga0307511_10101165
281 Ga0265327_10000929
282 Ga0265327_10281512
283 Ga0265316_10001426
284 Ga0307405_11418883
285 Ga0307406_10411292
286 Ga0307416_101038017
287 Ga0307415_100035347
288 Ga0373938_0125496
289 Ga0373943_0111599
290 Ga0373943_0736810
291 Ga0373937_0402250
292 Ga0373937_0778850
293 Ga0436365_1379372
294 Ga0439435_0051346
295 Ga0439435_0235861
296 Ga0451577_1289713
297 Ga0495638_0037046
298 Ga0495653_0757320
299 Ga0495662_0477499
300 Ga0495620_0002807
301 Ga0495630_0508886
302 Ga0495635_0037187
303 Ga0495624_0230186
304 Ga0495600_0013570
305 Ga0495581_0170240
306 Ga0495581_0770902
307 Ga0495680_0054406
308 Ga0501039_1325199
309 Ga0501073_0744813
310 nmdc:mga05p37_1009830_c1
311 nmdc:mga09592_110809_c1
312 nmdc:mga09592_378675_c1
313 nmdc:mga0qj67_668_c1
314 nmdc:mga06r32_118196_c1
315 nmdc:mga06r32_1497_c1
316 nmdc:mga08y16_281872_c1
317 nmdc:mga08y16_48233_c1
318 nmdc:mga0n895_1230782_c1
319 nmdc:mga0n895_1692809_c1
320 nmdc:mga08x19_405157_c1
321 nmdc:mga08x19_788289_c1
322 Ga0500592_041990

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04255

DUF433

Protein of unknown function (DUF433)

18

73

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ga1-assembly1.cif.gz_B crystal structure of a duf433 member protein (ava_0674) from anabaena variabilis atcc 29413 at 2.00 a resolution 0.805 6 65
2r0q-assembly1.cif.gz_F crystal structure of a serine recombinase- dna regulatory complex 0.7566 28 61
5cy1-assembly1.cif.gz_A tn3 resolvase - site iii complex crystal form i 0.6856 14 66
2ga1-assembly1.cif.gz_B crystal structure of a duf433 member protein (ava_0674) from anabaena variabilis atcc 29413 at 2.00 a resolution 0.6551 6 65
5cy1-assembly1.cif.gz_A tn3 resolvase - site iii complex crystal form i 0.4909 14 66
ID Description Score Start End Superfamily
2ga1B02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.859 12 65 1.10.10.10
af_P9WLC5_172_234_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.7747 16 65 1.10.10.10
2r0qF02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.7566 28 61 1.10.10.60
af_Q95XQ8_742_823_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.6862 28 65 1.10.10.10
2ga1B02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.6761 12 65 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A4Q3EFC7-F1-model_v4 DUF433 domain-containing protein 0.9869 13 67
AF-A0A2E1HDY0-F1-model_v4 DUF433 domain-containing protein 0.969 15 69
AF-A0A7Y5RXL3-F1-model_v4 DUF433 domain-containing protein 0.9644 15 64
AF-A0A7V0UL54-F1-model_v4 DUF433 domain-containing protein 0.9583 15 67
AF-A0A6L7YMJ1-F1-model_v4 DUF433 domain-containing protein 0.9546 15 74

Map