F236465

General Info

Members Datasets Scaffolds Average Seq Length
161 80 320 196

Family's Representative Sequence

Representative Sequence 3300005530|Ga0070679_100172919|Ga0070679_1001729192
Length 228
Sequence MISDTPGDLGQRRPADLALCQLPGEWLAAYNGPMLLRTRDAQRHTYADYLTWPDDDLCVGLIDGIAYVREPPGPSRVHQEWVGELYLQVRAALEGKPCRAYVAPFDVRLPKSAKSDDQIDTVVQPDILIVCDLRKLDARGMCGAPDWVAEVLSPSTASYDQVLKLRAYERAGVGEVWLVHPTDRTAALYRLEAGRYGRPIVLELRGKTALTAVPAVTVDWDRVTNGLA

Samples

Sample ID Description Type Environment
1 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
14 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
17 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
18 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
19 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
20 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
21 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
22 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
23 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
24 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
25 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
26 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
27 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
28 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
29 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
30 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
31 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
46 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
47 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
48 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
49 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
50 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
51 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
52 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
53 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
54 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
55 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
56 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
57 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
58 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
59 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
60 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
61 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
62 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
63 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
64 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
65 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
66 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
67 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
68 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
69 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
70 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
71 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
72 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
73 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
74 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
75 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
76 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
77 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
78 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
79 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
80 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.38
Metatranscriptomes 0
Isolates 0.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.24
Nodule 0
Rhizoplane 1.24
Rhizosphere 83.85
Stem 0
Stem Tuber 0
Unclassified 21.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070679_100172919 3300005530 Bacteria 2133
2 rootH2_10160992 3300003320 Bacteria 1437
3 rootH1_10273792 3300003323 Unclassified 3410
4 Ga0070683_100029279 3300005329 Bacteria 4983
5 Ga0070666_10133240 3300005335 Bacteria 1728
6 Ga0070680_100009037 3300005336 Bacteria 7640
7 Ga0070661_100714407 3300005344 Unclassified 817
8 Ga0070671_100164224 3300005355 Bacteria 1877
9 Ga0070709_10417269 3300005434 Bacteria 1005
10 Ga0070681_10009699 3300005458 Bacteria 9474
11 Ga0070681_10020373 3300005458 Bacteria 6647
12 Ga0070681_10066957 3300005458 Bacteria 3560
13 Ga0070681_10119653 3300005458 Plasmid 2569
14 Ga0070679_100000803 3300005530 Bacteria 27228
15 Ga0070679_100013814 3300005530 Bacteria 7738
16 Ga0070679_100146812 3300005530 Unclassified 2336
17 Ga0070665_100047884 3300005548 Bacteria 4291
18 Ga0070665_100060568 3300005548 Bacteria 3794
19 Ga0070665_100236559 3300005548 Bacteria 1827
20 Ga0068855_100010671 3300005563 Bacteria 11084
21 Ga0068855_100079468 3300005563 Bacteria 3804
22 Ga0068855_100436958 3300005563 Unclassified 1430
23 Ga0068855_100523063 3300005563 Unclassified 1287
24 Ga0068855_101117309 3300005563 Bacteria 823
25 Ga0068852_100954765 3300005616 Unclassified 875
26 Ga0068862_100047870 3300005844 Bacteria 3649
27 Ga0081455_10110362 3300005937 Unclassified 2187
28 Ga0097621_100280428 3300006237 Bacteria 1467
29 Ga0068871_100402964 3300006358 Bacteria 1218
30 Ga0105240_10001392 3300009093 Bacteria 41566
31 Ga0105240_10004463 3300009093 Bacteria 21320
32 Ga0105240_10005065 3300009093 Bacteria 19755
33 Ga0105240_10007264 3300009093 Bacteria 16125
34 Ga0105240_10008103 3300009093 Bacteria 15088
35 Ga0105240_10044663 3300009093 Bacteria 5627
36 Ga0105240_10069829 3300009093 Bacteria 4348
37 Ga0105240_10071956 3300009093 Unclassified 4275
38 Ga0105240_10086410 3300009093 Unclassified 3841
39 Ga0105240_10123113 3300009093 Bacteria 3121
40 Ga0105240_10250945 3300009093 Bacteria 2046
41 Ga0105240_10303410 3300009093 Bacteria 1826
42 Ga0105240_10845384 3300009093 Bacteria 988
43 Ga0105247_10777783 3300009101 Unclassified 728
44 Ga0105237_10057079 3300009545 Bacteria 3907
45 Ga0105237_10139345 3300009545 Bacteria 2420
46 Ga0105237_10207416 3300009545 Bacteria 1960
47 Ga0105237_10510708 3300009545 Bacteria 1208
48 Ga0105237_11522683 3300009545 Bacteria 676
49 Ga0105238_10000754 3300009551 Bacteria 33646
50 Ga0105238_10269791 3300009551 Bacteria 1682
51 Ga0105238_10610740 3300009551 Bacteria 1099
52 Ga0105238_11112891 3300009551 Unclassified 813
53 Ga0105249_10236254 3300009553 Bacteria 1805
54 Ga0105249_10843636 3300009553 Unclassified 982
55 Ga0105239_10024568 3300010375 Bacteria 6638
56 Ga0105239_10304199 3300010375 Bacteria 1796
57 Ga0105239_11918605 3300010375 Bacteria 687
58 Ga0157370_10000843 3300013104 Bacteria 38906
59 Ga0157370_10100763 3300013104 Unclassified 2706
60 Ga0157369_10004495 3300013105 Bacteria 16434
61 Ga0157369_10009229 3300013105 Bacteria 11283
62 Ga0157369_10030158 3300013105 Bacteria 5983
63 Ga0157369_10374028 3300013105 Unclassified 1479
64 Ga0157369_10456290 3300013105 Unclassified 1323
65 Ga0157374_10042192 3300013296 Bacteria 4207
66 Ga0157372_10089991 3300013307 Unclassified 3488
67 Ga0157372_10924371 3300013307 Bacteria 1012
68 Ga0157372_11394847 3300013307 Bacteria 808
69 Ga0163163_10259278 3300014325 Unclassified 1789
70 Ga0163163_10793237 3300014325 Bacteria 1010
71 Ga0157379_10508700 3300014968 Bacteria 1117
72 Ga0157376_10138194 3300014969 Bacteria 2183
73 Ga0207680_10005059 3300025903 Bacteria 6280
74 Ga0207699_10365401 3300025906 Bacteria 1021
75 Ga0207707_10000094 3300025912 Bacteria 89818
76 Ga0207707_10007491 3300025912 Bacteria 9510
77 Ga0207707_10099233 3300025912 Bacteria 2545
78 Ga0207707_10546378 3300025912 Unclassified 984
79 Ga0207695_10001793 3300025913 Bacteria 33891
80 Ga0207695_10004813 3300025913 Bacteria 18263
81 Ga0207695_10039080 3300025913 Bacteria 5102
82 Ga0207695_10055661 3300025913 Bacteria 4120
83 Ga0207695_10072325 3300025913 Bacteria 3519
84 Ga0207695_10097986 3300025913 Unclassified 2932
85 Ga0207695_10130559 3300025913 Bacteria 2470
86 Ga0207695_10224492 3300025913 Bacteria 1785
87 Ga0207695_10440153 3300025913 Bacteria 1187
88 Ga0207671_10346381 3300025914 Bacteria 1178
89 Ga0207660_10003384 3300025917 Bacteria 10397
90 Ga0207660_10213213 3300025917 Bacteria 1513
91 Ga0207652_10000807 3300025921 Bacteria 29901
92 Ga0207652_10087457 3300025921 Bacteria 2733
93 Ga0207652_10161985 3300025921 Bacteria 2006
94 Ga0207694_10009486 3300025924 Bacteria 7338
95 Ga0207694_10195342 3300025924 Bacteria 1645
96 Ga0207694_10413199 3300025924 Bacteria 1123
97 Ga0207700_10180772 3300025928 Bacteria 1766
98 Ga0207667_10001315 3300025949 Bacteria 31172
99 Ga0207667_10151070 3300025949 Bacteria 2391
100 Ga0207667_10384516 3300025949 Bacteria 1430
101 Ga0207667_10473954 3300025949 Bacteria 1271
102 Ga0207667_10482895 3300025949 Unclassified 1258
103 Ga0207667_10515179 3300025949 Unclassified 1212
104 Ga0207712_10225708 3300025961 Unclassified 1500
105 Ga0207698_10925208 3300026142 Unclassified 880
106 Ga0268266_10001570 3300028379 Bacteria 26707
107 Ga0268266_10006207 3300028379 Bacteria 10973
108 Ga0268266_10029728 3300028379 Bacteria 4642
109 Ga0268265_10010520 3300028380 Bacteria 6247
110 Ga0265334_10131392 3300028573 Unclassified 890
111 Ga0307511_10000152 3300030521 Bacteria 65858
112 Ga0307511_10000959 3300030521 Bacteria 30573
113 Ga0265331_10062653 3300031250 Bacteria 1753
114 Ga0307509_10000004 3300031507 Bacteria 535507
115 Ga0307508_10403168 3300031616 Bacteria 959
116 Ga0307510_10000008 3300033180 Bacteria 433990
117 Ga0373936_0055988 3300035113 Bacteria 1602
118 Ga0373943_0550593 3300035170 Bacteria 677
119 Ga0373933_0583192 3300035724 Bacteria 734
120 Ga0395900_0287494 3300037418 Unclassified 1634
121 Ga0395900_0761825 3300037418 Bacteria 898
122 Ga0395898_0031300 3300037466 Bacteria 5318
123 Ga0395898_0073983 3300037466 Bacteria 3292
124 Ga0395898_0109351 3300037466 Unclassified 2650
125 Ga0395898_0390656 3300037466 Bacteria 1327
126 Ga0395898_0558799 3300037466 Bacteria 1087
127 Ga0395898_0791835 3300037466 Bacteria 889
128 Ga0395905_1025573 3300037471 Unclassified 728
129 Ga0436365_1440346 3300039437 Bacteria 1238
130 Ga0466969_0000680 3300044656 Bacteria 18490
131 Ga0466969_0006814 3300044656 Bacteria 6076
132 Ga0466966_0019871 3300044684 Unclassified 4417
133 Ga0466961_0014472 3300044693 Bacteria 5066
134 Ga0466964_0018086 3300044706 Bacteria 2702
135 Ga0466971_0004945 3300044719 Bacteria 5766
136 Ga0466968_0057315 3300044735 Unclassified 1675
137 Ga0466968_0161850 3300044735 Bacteria 1033
138 Ga0466970_0011080 3300044765 Unclassified 4590
139 Ga0466957_0754078 3300044842 Unclassified 689
140 Ga0466959_0147685 3300045049 Bacteria 1658
141 Ga0466959_0209656 3300045049 Bacteria 1354
142 Ga0495625_0209019 3300046660 Unclassified 1284
143 Ga0495649_0249789 3300046694 Unclassified 911
144 Ga0496102_0005328 3300048905 Bacteria 10925
145 Ga0496103_0096598 3300048906 Bacteria 1867
146 Ga0496116_0036196 3300048919 Bacteria 3458
147 Ga0496117_0000117 3300048920 Bacteria 177596
148 Ga0496118_0000025 3300048921 Bacteria 379363
149 Ga0496119_0002422 3300048922 Bacteria 20484
150 Ga0496119_0045134 3300048922 Bacteria 2766
151 Ga0496120_0000098 3300048923 Bacteria 145165
152 Ga0496120_0183379 3300048923 Bacteria 1026
153 Ga0496125_0035062 3300048928 Bacteria 4410
154 Ga0496125_0051845 3300048928 Bacteria 3380
155 Ga0496126_0134123 3300048929 Bacteria 2137
156 Ga0496126_0157016 3300048929 Bacteria 1946
157 Ga0496126_0385441 3300048929 Unclassified 1140
158 Ga0500572_013659 3300053111 Bacteria 2015
159 Ga0500637_0003840 3300053178 Bacteria 6998
160 8001525201 8001522603 Bacteria 4726425
161 Ga0070679_100172919
162 rootH2_10160992
163 rootH1_10273792
164 Ga0070683_100029279
165 Ga0070666_10133240
166 Ga0070680_100009037
167 Ga0070661_100714407
168 Ga0070671_100164224
169 Ga0070709_10417269
170 Ga0070681_10009699
171 Ga0070681_10020373
172 Ga0070681_10066957
173 Ga0070681_10119653
174 Ga0070679_100000803
175 Ga0070679_100013814
176 Ga0070679_100146812
177 Ga0070665_100047884
178 Ga0070665_100060568
179 Ga0070665_100236559
180 Ga0068855_100010671
181 Ga0068855_100079468
182 Ga0068855_100436958
183 Ga0068855_100523063
184 Ga0068855_101117309
185 Ga0068852_100954765
186 Ga0068862_100047870
187 Ga0081455_10110362
188 Ga0097621_100280428
189 Ga0068871_100402964
190 Ga0105240_10001392
191 Ga0105240_10004463
192 Ga0105240_10005065
193 Ga0105240_10007264
194 Ga0105240_10008103
195 Ga0105240_10044663
196 Ga0105240_10069829
197 Ga0105240_10071956
198 Ga0105240_10086410
199 Ga0105240_10123113
200 Ga0105240_10250945
201 Ga0105240_10303410
202 Ga0105240_10845384
203 Ga0105247_10777783
204 Ga0105237_10057079
205 Ga0105237_10139345
206 Ga0105237_10207416
207 Ga0105237_10510708
208 Ga0105237_11522683
209 Ga0105238_10000754
210 Ga0105238_10269791
211 Ga0105238_10610740
212 Ga0105238_11112891
213 Ga0105249_10236254
214 Ga0105249_10843636
215 Ga0105239_10024568
216 Ga0105239_10304199
217 Ga0105239_11918605
218 Ga0157370_10000843
219 Ga0157370_10100763
220 Ga0157369_10004495
221 Ga0157369_10009229
222 Ga0157369_10030158
223 Ga0157369_10374028
224 Ga0157369_10456290
225 Ga0157374_10042192
226 Ga0157372_10089991
227 Ga0157372_10924371
228 Ga0157372_11394847
229 Ga0163163_10259278
230 Ga0163163_10793237
231 Ga0157379_10508700
232 Ga0157376_10138194
233 Ga0207680_10005059
234 Ga0207699_10365401
235 Ga0207707_10000094
236 Ga0207707_10007491
237 Ga0207707_10099233
238 Ga0207707_10546378
239 Ga0207695_10001793
240 Ga0207695_10004813
241 Ga0207695_10039080
242 Ga0207695_10055661
243 Ga0207695_10072325
244 Ga0207695_10097986
245 Ga0207695_10130559
246 Ga0207695_10224492
247 Ga0207695_10440153
248 Ga0207671_10346381
249 Ga0207660_10003384
250 Ga0207660_10213213
251 Ga0207652_10000807
252 Ga0207652_10087457
253 Ga0207652_10161985
254 Ga0207694_10009486
255 Ga0207694_10195342
256 Ga0207694_10413199
257 Ga0207700_10180772
258 Ga0207667_10001315
259 Ga0207667_10151070
260 Ga0207667_10384516
261 Ga0207667_10473954
262 Ga0207667_10482895
263 Ga0207667_10515179
264 Ga0207712_10225708
265 Ga0207698_10925208
266 Ga0268266_10001570
267 Ga0268266_10006207
268 Ga0268266_10029728
269 Ga0268265_10010520
270 Ga0265334_10131392
271 Ga0307511_10000152
272 Ga0307511_10000959
273 Ga0265331_10062653
274 Ga0307509_10000004
275 Ga0307508_10403168
276 Ga0307510_10000008
277 Ga0373936_0055988
278 Ga0373943_0550593
279 Ga0373933_0583192
280 Ga0395900_0287494
281 Ga0395900_0761825
282 Ga0395898_0031300
283 Ga0395898_0073983
284 Ga0395898_0109351
285 Ga0395898_0390656
286 Ga0395898_0558799
287 Ga0395898_0791835
288 Ga0395905_1025573
289 Ga0436365_1440346
290 Ga0466969_0000680
291 Ga0466969_0006814
292 Ga0466966_0019871
293 Ga0466961_0014472
294 Ga0466964_0018086
295 Ga0466971_0004945
296 Ga0466968_0057315
297 Ga0466968_0161850
298 Ga0466970_0011080
299 Ga0466957_0754078
300 Ga0466959_0147685
301 Ga0466959_0209656
302 Ga0495625_0209019
303 Ga0495649_0249789
304 Ga0496102_0005328
305 Ga0496103_0096598
306 Ga0496116_0036196
307 Ga0496117_0000117
308 Ga0496118_0000025
309 Ga0496119_0002422
310 Ga0496119_0045134
311 Ga0496120_0000098
312 Ga0496120_0183379
313 Ga0496125_0035062
314 Ga0496125_0051845
315 Ga0496126_0134123
316 Ga0496126_0157016
317 Ga0496126_0385441
318 Ga0500572_013659
319 Ga0500637_0003840
320 8001525201

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05685

Uma2

Putative restriction endonuclease

46

222

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6okh-assembly1.cif.gz_B structure of an uncharacterized protein from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.8961 9 188
6okh-assembly1.cif.gz_B structure of an uncharacterized protein from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.8769 9 188
1wdj-assembly1.cif.gz_B crystal structure of tt1808 from thermus thermophilus hb8 0.8019 37 188
1wdj-assembly1.cif.gz_B crystal structure of tt1808 from thermus thermophilus hb8 0.778 37 188
3ot2-assembly1.cif.gz_B crystal structure of a putative nuclease belonging to duf820 (ava_3926) from anabaena variabilis atcc 29413 at 1.96 a resolution 0.7762 26 192
ID Description Score Start End Superfamily
af_A0A0P0YCS0_347_573_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8113 140 169 2.130.10.10
1wdjB00 Alpha Beta;Alpha-Beta Complex;tt1808, chain A;tt1808, chain A 0.8019 37 188 3.90.1570.10
af_Q558X8_9_133_3.30.450.30 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.795 139 168 3.30.450.30
af_C0H581_281_381_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7843 139 168 2.60.40.790
1wdjB00 Alpha Beta;Alpha-Beta Complex;tt1808, chain A;tt1808, chain A 0.778 37 188 3.90.1570.10
ID Description Score Start End GO Terms
AF-A0A7V2Z3B0-F1-model_v4 Uma2 family endonuclease 0.9849 69 190 GO:0004519
AF-A0A2W4R3V1-F1-model_v4 Putative restriction endonuclease domain-containing protein 0.9704 1 165
AF-A0A3D5EZW1-F1-model_v4 Putative restriction endonuclease domain-containing protein 0.9704 37 192
AF-A0A353GEW2-F1-model_v4 Uma2 family endonuclease 0.9683 40 188 GO:0004519
AF-A0A3D3AMJ5-F1-model_v4 Uma2 family endonuclease 0.9659 86 188 GO:0004519

Map