F235850

General Info

Members Datasets Scaffolds Average Seq Length
160 130 320 305

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|3001267043|3001271402
Length 302
Sequence VEIKNVTKTIRGKKIIDDLSFEVMEGEVFGFLGPNGAGKTTTIRMMVGLIGITSGEIVICGKNVVKEYEEAIKHVGAIVENPELYKFLTGYQNLEQVARLIKGITKEKIDEVIELVGLKDRIHDKVKTYSLGMRQRLGIAQSLLHDPKILILDEPTNGLDPAGIREIRDYLRSLARDKGMSVIVSSHLLSEMEMMCDRIAIIQKGKLINVQHVRDDNNTNEKEYVFIVNNRKKALNLLDKQGLSPKVSGEGIGLVLNKEQVPNVINLLVLNDFLIYEVKGQTRTLEDRFLEITNGREVAANA

Samples

Sample ID Description Type Environment
1 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
2 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
3 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
4 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
5 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
6 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
7 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
8 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
9 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
10 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
11 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
12 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
13 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
14 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
15 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
16 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
17 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
18 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
19 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
20 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
21 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
22 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
23 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
24 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
25 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
26 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
27 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
28 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
29 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
30 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
31 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
32 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
33 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
34 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
35 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
36 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
37 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
38 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
39 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
40 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
41 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
42 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
43 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
44 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
45 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
46 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
47 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
48 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
49 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
50 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
51 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
52 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
53 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
54 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
55 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
56 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
57 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
58 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
59 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
60 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
61 2818991459 Paenibacillus sp. 597 Isolate Unclassified
62 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
63 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
64 2857472729 Cohnella sp. R-74144 Isolate Unclassified
65 2860837431 Bacillus sp. WR11 Isolate Unclassified
66 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
67 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
68 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
69 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
70 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
71 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
72 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
73 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
74 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
75 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
76 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
77 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
78 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
79 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
80 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
81 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
82 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
83 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
84 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
85 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
86 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
87 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
88 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
89 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
90 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
91 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
92 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
93 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
94 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
95 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
96 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
97 2969141011 Bacillus velezensis MH25 Isolate Unclassified
98 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
99 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
100 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
101 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
102 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
103 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
104 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
105 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
106 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
107 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
108 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
109 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
110 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
111 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
112 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
113 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
114 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
115 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
116 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
117 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
118 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
119 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
120 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
121 8022653035 Bacillus sp. Rc4 Isolate Unclassified
122 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
123 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
124 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
125 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
126 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
127 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
128 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
129 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere
130 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 35.62
Metatranscriptomes 1.25
Isolates 63.12

Biome Distribution

Category Percentage (%)
Aerial Root 1.25
Bulb 0
Endosphere 10.62
Nodule 0.62
Rhizoplane 0.62
Rhizosphere 47.5
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055538_1000186 3300003751 Bacteria 38030
2 Ga0055536_1025222 3300003781 Bacteria 1700
3 Ga0055541_1000520 3300003841 Bacteria 10703
4 Ga0055541_1004439 3300003841 Bacteria 2544
5 Ga0055541_1010100 3300003841 Bacteria 1434
6 Ga0105244_10005169 3300009036 Bacteria 8746
7 Ga0157371_10015938 3300013102 Bacteria 5623
8 Ga0209784_100411 3300025224 Bacteria 19293
9 Ga0209566_100033 3300025225 Bacteria 332650
10 Ga0209566_100059 3300025225 Bacteria 199785
11 Ga0209566_100080 3300025225 Bacteria 156454
12 Ga0209566_100099 3300025225 Bacteria 134195
13 Ga0209566_101349 3300025225 Bacteria 7762
14 Ga0209437_100690 3300025233 Bacteria 17826
15 Ga0209676_1000277 3300025292 Bacteria 106682
16 Ga0209676_1029561 3300025292 Bacteria 1690
17 Ga0209025_1000621 3300025294 Bacteria 62957
18 Ga0209025_1000757 3300025294 Bacteria 53988
19 Ga0209025_1007066 3300025294 Bacteria 8498
20 Ga0207655_1014497 3300025728 Bacteria 4450
21 Ga0207713_1066790 3300025735 Bacteria 1344
22 Ga0439449_0049413 3300042007 Bacteria 1556
23 Ga0466969_0004088 3300044656 Bacteria 7739
24 Ga0466961_0151782 3300044693 Bacteria 1446
25 Ga0466968_0007303 3300044735 Bacteria 4198
26 Ga0466959_0010479 3300045049 Bacteria 6630
27 Ga0495637_0026700 3300046520 Bacteria 2589
28 Ga0495660_0084721 3300046810 Bacteria 1657
29 Ga0495626_0062394 3300048091 Bacteria 1693
30 Ga0496116_0002952 3300048919 Bacteria 17319
31 Ga0496116_0051381 3300048919 Bacteria 2739
32 Ga0496116_0069961 3300048919 Bacteria 2229
33 Ga0496116_0128896 3300048919 Bacteria 1447
34 Ga0496117_0006783 3300048920 Bacteria 11427
35 Ga0496117_0054558 3300048920 Bacteria 2799
36 Ga0496118_0020635 3300048921 Bacteria 5836
37 Ga0496119_0021985 3300048922 Bacteria 4585
38 Ga0496120_0001462 3300048923 Bacteria 28199
39 Ga0496120_0015397 3300048923 Bacteria 5046
40 Ga0496120_0140190 3300048923 Bacteria 1228
41 Ga0496121_0028126 3300048924 Bacteria 5240
42 Ga0496121_0070432 3300048924 Bacteria 2817
43 Ga0496121_0074360 3300048924 Bacteria 2718
44 Ga0496122_0005008 3300048925 Bacteria 16025
45 Ga0496122_0016491 3300048925 Bacteria 6983
46 Ga0496122_0020449 3300048925 Bacteria 5980
47 Ga0496122_0045461 3300048925 Bacteria 3412
48 Ga0496122_0045676 3300048925 Bacteria 3401
49 Ga0496122_0062326 3300048925 Bacteria 2731
50 Ga0496124_0000698 3300048927 Bacteria 54996
51 Ga0496124_0146943 3300048927 Bacteria 1854
52 Ga0496125_0002032 3300048928 Bacteria 27422
53 Ga0496125_0030304 3300048928 Bacteria 4842
54 Ga0496126_0003431 3300048929 Bacteria 20000
55 Ga0496126_0010153 3300048929 Bacteria 9913
56 Ga0496126_0024971 3300048929 Bacteria 5761
57 Ga0501306_000290 3300049127 Bacteria 3611
58 Ga0501309_000211 3300049129 Bacteria 4038
59 Ga0501208_002083 3300049655 Bacteria 2037
60 3001271402 3001267043 Bacteria 4823521
61 2511698840 2511231119 Bacteria 4019861
62 2512735939 2512564039 Bacteria 8739048
63 2524188808 2524023129 Bacteria 6762600
64 2540606051 2540341094 Bacteria 4061186
65 2545558052 2545555800 Bacteria 4222588
66 2550904763 2548877040 Bacteria 7507281
67 2563927998 2563366752 Bacteria 4961801
68 2571527669 2571042143 Bacteria 6986194
69 2573037351 2571042588 Bacteria 5045676
70 2578335533 2576861424 Bacteria 5270569
71 2578932471 2576861599 Bacteria 4217202
72 2580934696 2579778775 Bacteria 5360914
73 2587740133 2585428059 Bacteria 8696589
74 2595319770 2593339198 Bacteria 7267884
75 2595320927 2593339198 Bacteria 7267884
76 2601639839 2600255286 Bacteria 5390125
77 2621273760 2619619294 Bacteria 5575484
78 2644425278 2643221676 Bacteria 8119172
79 2651530246 2648501850 Bacteria 3975476
80 2674420144 2671180844 Bacteria 4164150
81 2695626760 2695420354 Bacteria 3922431
82 2723602737 2721755693 Bacteria 6126117
83 2728531812 2728368933 Bacteria 7044283
84 2730138711 2728369359 Bacteria 5621728
85 2753809441 2751185905 Bacteria 6142767
86 2802438938 2802428803 Bacteria 5806948
87 2809054248 2808606399 Bacteria 4021018
88 2819671366 2818991459 Bacteria 8736032
89 2821115741 2821111986 Bacteria 6894338
90 2857455237 2857453340 Bacteria 8090534
91 2857476204 2857472729 Bacteria 6568124
92 2860838422 2860837431 Bacteria 4202080
93 2864738592 2864733723 Bacteria 6770668
94 2865002266 2864997549 Bacteria 5139696
95 2865007300 2865002811 Bacteria 6333767
96 2877769579 2877768649 Bacteria 3957164
97 2880170576 2880169592 Bacteria 3900066
98 2881638232 2881636855 Bacteria 5205297
99 2885531279 2885526491 Bacteria 7164189
100 2888583111 2888578766 Bacteria 6743310
101 2889043846 2889042446 Bacteria 7618936
102 2889050909 2889049205 Bacteria 7524325
103 2889054665 2889049205 Bacteria 7524325
104 2889278696 2889276214 Bacteria 5979355
105 2889300395 2889295896 Bacteria 4704906
106 2897110560 2897109615 Bacteria 4009619
107 2904166455 2904162308 Bacteria 7086713
108 2904494959 2904490793 Bacteria 7046938
109 2904563073 2904560550 Bacteria 4029838
110 2904598699 2904595352 Bacteria 6124848
111 2904756403 2904755435 Bacteria 7986759
112 2907204881 2907202186 Bacteria 6632024
113 2919163819 2919160200 Bacteria 6929020
114 2919430713 2919425241 Bacteria 8055701
115 2925327933 2925326138 Bacteria 9652120
116 2931387309 2931384279 Bacteria 7299545
117 2938654384 2938649242 Bacteria 7118381
118 2939683564 2939679117 Bacteria 6921672
119 2939703818 2939702853 Bacteria 5139229
120 2945994112 2945991243 Bacteria 7008369
121 2946056872 2946053406 Bacteria 6978655
122 2962291781 2962290636 Bacteria 4072939
123 2968562992 2968558590 Bacteria 6956864
124 2969137831 2969136845 Bacteria 3923176
125 2969142027 2969141011 Bacteria 4118468
126 2969771615 2969770375 Bacteria 4271280
127 2971403924 2971403814 Bacteria 7370929
128 2971412428 2971410472 Bacteria 8311090
129 2971513188 2971511577 Bacteria 5404012
130 2980130282 2980125574 Bacteria 5567337
131 2980178608 2980176882 Bacteria 5397533
132 2980183529 2980182181 Bacteria 9454109
133 2980185781 2980182181 Bacteria 9454109
134 2980493606 2980492589 Bacteria 4072961
135 2981287691 2981284811 Bacteria 4641497
136 2981292885 2981289755 Bacteria 4641509
137 2981982901 2981980479 Bacteria 4641628
138 2981987811 2981985349 Bacteria 4641497
139 2984528283 2984527788 Bacteria 5288478
140 2984534389 2984532647 Bacteria 5288506
141 2988230988 2988225383 Bacteria 7221625
142 2996633204 2996632988 Bacteria 6921523
143 3001272344 3001272096 Bacteria 4729684
144 3006880064 3006879489 Bacteria 4064221
145 3006987935 3006984091 Bacteria 4207523
146 3006992485 3006988479 Bacteria 4767936
147 648169081 648028048 Bacteria 5394884
148 8002320284 8002317523 Bacteria 8051857
149 8022633787 8022630665 Bacteria 3886130
150 8022654994 8022653035 Bacteria 4035078
151 8046995399 8046991243 Bacteria 8497463
152 8051953601 8051952484 Bacteria 3926774
153 8052176976 8052174270 Bacteria 3881265
154 8054466394 8054465665 Bacteria 7323556
155 8054800752 8054795415 Bacteria 9785225
156 8055635981 8055632911 Bacteria 5283357
157 8056533101 8056533031 Bacteria 8964429
158 8057736264 8057733483 Bacteria 6578323
159 8057978191 8057977335 Bacteria 5694872
160 8057979332 8057977335 Bacteria 5694872
161 Ga0055538_1000186
162 Ga0055536_1025222
163 Ga0055541_1000520
164 Ga0055541_1004439
165 Ga0055541_1010100
166 Ga0105244_10005169
167 Ga0157371_10015938
168 Ga0209784_100411
169 Ga0209566_100033
170 Ga0209566_100059
171 Ga0209566_100080
172 Ga0209566_100099
173 Ga0209566_101349
174 Ga0209437_100690
175 Ga0209676_1000277
176 Ga0209676_1029561
177 Ga0209025_1000621
178 Ga0209025_1000757
179 Ga0209025_1007066
180 Ga0207655_1014497
181 Ga0207713_1066790
182 Ga0439449_0049413
183 Ga0466969_0004088
184 Ga0466961_0151782
185 Ga0466968_0007303
186 Ga0466959_0010479
187 Ga0495637_0026700
188 Ga0495660_0084721
189 Ga0495626_0062394
190 Ga0496116_0002952
191 Ga0496116_0051381
192 Ga0496116_0069961
193 Ga0496116_0128896
194 Ga0496117_0006783
195 Ga0496117_0054558
196 Ga0496118_0020635
197 Ga0496119_0021985
198 Ga0496120_0001462
199 Ga0496120_0015397
200 Ga0496120_0140190
201 Ga0496121_0028126
202 Ga0496121_0070432
203 Ga0496121_0074360
204 Ga0496122_0005008
205 Ga0496122_0016491
206 Ga0496122_0020449
207 Ga0496122_0045461
208 Ga0496122_0045676
209 Ga0496122_0062326
210 Ga0496124_0000698
211 Ga0496124_0146943
212 Ga0496125_0002032
213 Ga0496125_0030304
214 Ga0496126_0003431
215 Ga0496126_0010153
216 Ga0496126_0024971
217 Ga0501306_000290
218 Ga0501309_000211
219 Ga0501208_002083
220 3001271402
221 2511698840
222 2512735939
223 2524188808
224 2540606051
225 2545558052
226 2550904763
227 2563927998
228 2571527669
229 2573037351
230 2578335533
231 2578932471
232 2580934696
233 2587740133
234 2595319770
235 2595320927
236 2601639839
237 2621273760
238 2644425278
239 2651530246
240 2674420144
241 2695626760
242 2723602737
243 2728531812
244 2730138711
245 2753809441
246 2802438938
247 2809054248
248 2819671366
249 2821115741
250 2857455237
251 2857476204
252 2860838422
253 2864738592
254 2865002266
255 2865007300
256 2877769579
257 2880170576
258 2881638232
259 2885531279
260 2888583111
261 2889043846
262 2889050909
263 2889054665
264 2889278696
265 2889300395
266 2897110560
267 2904166455
268 2904494959
269 2904563073
270 2904598699
271 2904756403
272 2907204881
273 2919163819
274 2919430713
275 2925327933
276 2931387309
277 2938654384
278 2939683564
279 2939703818
280 2945994112
281 2946056872
282 2962291781
283 2968562992
284 2969137831
285 2969142027
286 2969771615
287 2971403924
288 2971412428
289 2971513188
290 2980130282
291 2980178608
292 2980183529
293 2980185781
294 2980493606
295 2981287691
296 2981292885
297 2981982901
298 2981987811
299 2984528283
300 2984534389
301 2988230988
302 2996633204
303 3001272344
304 3006880064
305 3006987935
306 3006992485
307 648169081
308 8002320284
309 8022633787
310 8022654994
311 8046995399
312 8051953601
313 8052176976
314 8054466394
315 8054800752
316 8055635981
317 8056533101
318 8057736264
319 8057978191
320 8057979332

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

16

157

0.97

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

106

193

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vpl-assembly1.cif.gz_A-2 crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution 0.929 6 218
7ch8-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with adp-v 0.9136 4 219
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.9129 7 219
6z67-assembly2.cif.gz_B ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.9059 4 220
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.9029 4 222
ID Description Score Start End Superfamily
af_O33189_10_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9521 2 218 3.40.50.300
af_P9WQL9_1_244_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9419 1 218 3.40.50.300
af_Q9VVJ9_503_747_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.936 1 212 3.40.50.300
af_Q555Z5_479_734_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9345 1 218 3.40.50.300
af_Q9XW49_1237_1482_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9345 1 218 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A662BGZ5-F1-model_v4 Gliding motility-associated ABC transporter ATP-binding subunit GldA 0.9641 7 195 GO:0005524
GO:0016887
AF-A0A2V6WXH7-F1-model_v4 AAA+ ATPase domain-containing protein 0.9571 3 165 GO:0005524
GO:0016887
AF-A0A0N1KPJ6-F1-model_v4 ABC transporter ATP-binding protein 0.9557 4 219 GO:0005524
GO:0016887
AF-A0A7C6CAI4-F1-model_v4 ABC transporter ATP-binding protein 0.9501 4 219 GO:0005524
GO:0016887
AF-A0A662BGZ5-F1-model_v4 Gliding motility-associated ABC transporter ATP-binding subunit GldA 0.9492 7 195 GO:0005524
GO:0016887

Map