F235525

General Info

Members Datasets Scaffolds Average Seq Length
160 117 102 282

Family's Representative Sequence

Representative Sequence 3300048927|Ga0496124_0082174|Ga0496124_0082174_665_1534
Length 289
Sequence VSEVAVTLADVSRRLRIASVNVNGIRAAARKGMHEWLETADVDILTLQEVRAQASDLAAALPGWHFVSDEALAKGRAGVAIAAREPLDVWRIELGDDDLDSKGRWVEADIEVAGEHLTVVSAYVFTGEADTEKQVAKYAFLDAMEKRMPQLGELAVITGDLNVGHREFDIRNWRGNRKKAGFLPRERAYFDRFTAPAGVEVDTVDGERGTGLGWVDVGRRFAGEVDGPYTWWSNRGKAFDTDTGWRIDYHLATPQLAERVTDYRVVRAPSWDTRWSDHAPVVADYDFPG

Samples

Sample ID Description Type Environment
1 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
2 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
3 2643221546 Microbacterium sp. Root53 Isolate Unclassified
4 2643221566 Microbacterium sp. Root166 Isolate Unclassified
5 2643221575 Microbacterium sp. Root61 Isolate Unclassified
6 2643221597 Microbacterium sp. Root180 Isolate Unclassified
7 2643221630 Microbacterium sp. Root322 Isolate Unclassified
8 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
9 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
10 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
11 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
12 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
13 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
14 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
15 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
16 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
17 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
18 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
19 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
20 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
21 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
22 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
23 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
24 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
25 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
26 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
27 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
28 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
29 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
30 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
31 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
32 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
33 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
34 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
35 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
36 2919069694 Microbacterium sp. 1154 Isolate Unclassified
37 2919395869 Microbacterium resistens 2980 Isolate Unclassified
38 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
39 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
40 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
41 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
42 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
43 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
44 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
45 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
46 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
47 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
48 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
49 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
50 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
51 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
52 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
53 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
54 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
55 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
56 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
57 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
62 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
65 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
70 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
71 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
72 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
73 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
74 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
75 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
76 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
77 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
78 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
79 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
80 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
81 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
82 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
83 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
84 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
85 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
86 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
87 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
88 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
89 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
90 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
91 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
92 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
93 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
94 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
95 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
96 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
97 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
98 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
99 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
100 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
101 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
102 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
103 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
107 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
108 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
109 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
110 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
111 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
112 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
113 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
114 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
115 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
116 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
117 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 62.5
Metatranscriptomes 1.25
Isolates 36.25

Biome Distribution

Category Percentage (%)
Aerial Root 1.88
Bulb 0
Endosphere 7.5
Nodule 0
Rhizoplane 8.12
Rhizosphere 36.25
Stem 0
Stem Tuber 0
Unclassified 46.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006562J51391_1060070 3300003578 Bacteria 13700
2 Ga0006562J51391_1060071 3300003578 Bacteria 9073
3 Ga0070683_100354148 3300005329 Bacteria 1398
4 Ga0070659_100048935 3300005366 Bacteria 3323
5 Ga0070667_100199526 3300005367 Bacteria 1775
6 Ga0068853_100036750 3300005539 Bacteria 4166
7 Ga0075365_10067455 3300006038 Bacteria 2402
8 Ga0075364_10002439 3300006051 Bacteria 10414
9 Ga0075369_10000835 3300006186 Bacteria 10166
10 Ga0171462_1001 3300013250 Bacteria 1135406
11 Ga0157372_10014043 3300013307 Bacteria 8556
12 Ga0209646_1000209 3300025246 Bacteria 66608
13 Ga0207655_1040981 3300025728 Bacteria 1989
14 Ga0207647_10273024 3300025904 Bacteria 966
15 Ga0207690_10261123 3300025932 Bacteria 1342
16 Ga0207658_10226857 3300025986 Bacteria 1574
17 Ga0307515_10072121 3300028794 Bacteria 4668
18 Ga0307408_100222485 3300031548 Bacteria 1541
19 Ga0307405_10116483 3300031731 Bacteria 1820
20 Ga0307406_10000126 3300031901 Bacteria 44932
21 Ga0307406_10001587 3300031901 Bacteria 12506
22 Ga0307406_10044275 3300031901 Bacteria 2789
23 Ga0307406_10305504 3300031901 Bacteria 1224
24 Ga0307409_100259180 3300031995 Bacteria 1595
25 Ga0307409_100583743 3300031995 Bacteria 1102
26 Ga0316574_0033157 3300035398 Bacteria 3143
27 Ga0316582_0008968 3300036647 Bacteria 5403
28 Ga0395898_0137658 3300037466 Bacteria 2338
29 Ga0451791_1726022 3300041451 Bacteria 1035
30 Ga0451853_0259850 3300041512 Bacteria 1186
31 Ga0451853_1038751 3300041512 Bacteria 1328
32 Ga0466965_0015806 3300044683 Bacteria 3586
33 Ga0466970_0010516 3300044765 Bacteria 4699
34 Ga0466970_0128791 3300044765 Bacteria 1389
35 Ga0495627_000645 3300046453 Bacteria 27237
36 Ga0495645_0030188 3300046543 Bacteria 3947
37 Ga0495649_0141420 3300046694 Bacteria 1267
38 Ga0496100_0031461 3300048903 Bacteria 3299
39 Ga0496102_0120247 3300048905 Bacteria 2453
40 Ga0496105_0038116 3300048908 Bacteria 3960
41 Ga0496105_0194040 3300048908 Bacteria 1659
42 Ga0496107_0011280 3300048910 Bacteria 6220
43 Ga0496108_0122304 3300048911 Bacteria 2233
44 Ga0496110_0085937 3300048913 Bacteria 2808
45 Ga0496111_0151434 3300048914 Bacteria 1720
46 Ga0496113_0372847 3300048916 Bacteria 1145
47 Ga0496114_0014184 3300048917 Bacteria 6393
48 Ga0496114_0133304 3300048917 Bacteria 2147
49 Ga0496114_0498342 3300048917 Bacteria 1077
50 Ga0496116_0077050 3300048919 Bacteria 2085
51 Ga0496117_0001396 3300048920 Bacteria 35051
52 Ga0496117_0001427 3300048920 Bacteria 34547
53 Ga0496117_0207814 3300048920 Bacteria 1100
54 Ga0496118_0000240 3300048921 Bacteria 96796
55 Ga0496118_0007542 3300048921 Bacteria 11490
56 Ga0496118_0026277 3300048921 Bacteria 4965
57 Ga0496118_0098227 3300048921 Bacteria 1989
58 Ga0496119_0001581 3300048922 Bacteria 27095
59 Ga0496119_0003987 3300048922 Bacteria 14945
60 Ga0496119_0011696 3300048922 Bacteria 7224
61 Ga0496119_0019397 3300048922 Bacteria 5011
62 Ga0496119_0061816 3300048922 Bacteria 2234
63 Ga0496119_0072824 3300048922 Bacteria 2006
64 Ga0496120_0000697 3300048923 Bacteria 49216
65 Ga0496120_0002616 3300048923 Bacteria 17850
66 Ga0496120_0003470 3300048923 Bacteria 14346
67 Ga0496120_0175124 3300048923 Bacteria 1058
68 Ga0496122_0000020 3300048925 Bacteria 401675
69 Ga0496122_0016521 3300048925 Bacteria 6975
70 Ga0496122_0108965 3300048925 Bacteria 1825
71 Ga0496122_0123303 3300048925 Bacteria 1665
72 Ga0496122_0145195 3300048925 Bacteria 1476
73 Ga0496123_0000003 3300048926 Bacteria 866556
74 Ga0496123_0000718 3300048926 Bacteria 54060
75 Ga0496123_0038971 3300048926 Bacteria 3330
76 Ga0496124_0000070 3300048927 Bacteria 220875
77 Ga0496124_0006293 3300048927 Bacteria 12973
78 Ga0496124_0062500 3300048927 Bacteria 3115
79 Ga0496124_0082174 3300048927 Bacteria 2645
80 Ga0496124_0090295 3300048927 Bacteria 2499
81 Ga0496124_0142709 3300048927 Bacteria 1888
82 Ga0496124_0414710 3300048927 Bacteria 930
83 Ga0496125_0002974 3300048928 Bacteria 21303
84 Ga0496125_0005563 3300048928 Bacteria 13932
85 Ga0496125_0016805 3300048928 Bacteria 7014
86 Ga0496125_0022517 3300048928 Bacteria 5848
87 Ga0496125_0086921 3300048928 Bacteria 2363
88 Ga0496126_0004323 3300048929 Bacteria 17042
89 Ga0496126_0014147 3300048929 Bacteria 8076
90 Ga0501034_0000550 3300049571 Bacteria 59510
91 Ga0501038_0225591 3300049574 Bacteria 1493
92 Ga0501039_0128521 3300049575 Bacteria 1988
93 Ga0501070_0000372 3300049586 Bacteria 40805
94 nmdc:mga00v17_399710_c1 3300050491 Bacteria 893
95 nmdc:mga0yw44_99444_c1 3300050492 Bacteria 1851
96 nmdc:mga0sz30_104705_c1 3300050516 Bacteria 1237
97 Ga0500650_0006916 3300053098 Bacteria 4372
98 Ga0500559_0000319 3300053136 Bacteria 36445
99 Ga0500559_0005680 3300053136 Bacteria 5706
100 Ga0500559_0175978 3300053136 Bacteria 1007
101 Ga0500573_0000001 3300053140 Bacteria 436394
102 Ga0500573_0003287 3300053140 Bacteria 8335

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2861520306 2861521917 252
2 3300028794 Ga0307515_10072121 Ga0307515_100721213 256
3 3300050491 nmdc:mga00v17_399710_c1 nmdc:mga00v17_399710_c1_13_789 256
4 3300041512 Ga0451853_0259850 Ga0451853_0259850_30_812 258
5 3300048920 Ga0496117_0207814 Ga0496117_0207814_159_941 258
6 3300048927 Ga0496124_0414710 Ga0496124_0414710_129_911 258
7 3300035398 Ga0316574_0033157 Ga0316574_0033157_2005_2829 259
8 3300036647 Ga0316582_0008968 Ga0316582_0008968_4203_5027 259
9 3300005329 Ga0070683_100354148 Ga0070683_1003541482 260
10 3300037466 Ga0395898_0137658 Ga0395898_0137658_501_1313 260
11 3300025904 Ga0207647_10273024 Ga0207647_102730241 263
12 3300048917 Ga0496114_0498342 Ga0496114_0498342_179_994 269
13 iso_pu_bacteria 8004212874 8004213506 272
14 iso_pu_bacteria 2643221542 2643735036 273
15 iso_pu_bacteria 2643221630 2644173198 273
16 iso_pu_bacteria 2808606368 2808884949 273
17 iso_pu_bacteria 2852646457 2852649500 273
18 iso_pu_bacteria 2852663356 2852665643 273
19 iso_pu_bacteria 2857723135 2857724993 273
20 iso_pu_bacteria 2904501621 2904503953 273
21 iso_pu_bacteria 2908674828 2908676918 273
22 iso_pu_bacteria 2909074476 2909076907 273
23 iso_pu_bacteria 2919039151 2919039519 273
24 iso_pu_bacteria 2919042368 2919042918 273
25 iso_pu_bacteria 2919395869 2919396719 273
26 iso_pu_bacteria 2928104781 2928105979 273
27 iso_pu_bacteria 2928500415 2928502060 273
28 iso_pu_bacteria 2945968032 2945968400 273
29 iso_pu_bacteria 2946041624 2946044850 273
30 iso_pu_bacteria 2946080515 2946084522 273
31 iso_pu_bacteria 2984551494 2984554799 273
32 iso_pu_bacteria 8004182704 8004185737 273
33 iso_pu_bacteria 2643221635 2644197133 274
34 iso_pu_bacteria 2852643534 2852646358 274
35 iso_pu_bacteria 2852677369 2852680812 274
36 iso_pu_bacteria 2857729791 2857732119 274
37 iso_pu_bacteria 2862993130 2862994666 274
38 iso_pu_bacteria 2870622029 2870624673 274
39 iso_pu_bacteria 2928121344 2928124983 274
40 iso_pu_bacteria 2939657138 2939660257 274
41 iso_pu_bacteria 2966924647 2966927237 274
42 iso_pu_bacteria 8055037949 8055040359 274
43 iso_pu_bacteria 2643221546 2643753149 275
44 iso_pu_bacteria 2833709550 2833710157 275
45 iso_pu_bacteria 2857720070 2857722246 275
46 iso_pu_bacteria 2870628048 2870629621 275
47 iso_pu_bacteria 2928090899 2928091090 275
48 iso_pu_bacteria 2977251589 2977251927 275
49 3300048908 Ga0496105_0038116 Ga0496105_0038116_1920_2756 276
50 3300048916 Ga0496113_0372847 Ga0496113_0372847_238_1074 276
51 iso_pu_bacteria 2643221597 2643996578 276
52 iso_pu_bacteria 2757320536 2758224539 276
53 iso_pu_bacteria 2811994872 2812322332 276
54 iso_pu_bacteria 2821268502 2821269254 276
55 iso_pu_bacteria 2852632344 2852632949 276
56 iso_pu_bacteria 2904509784 2904510152 276
57 iso_pu_bacteria 2908678064 2908678628 276
58 iso_pu_bacteria 2919069694 2919070979 276
59 iso_pu_bacteria 2977236895 2977239326 276
60 iso_pu_bacteria 2984542743 2984542889 276
61 iso_pu_bacteria 8016254467 8016254813 276
62 3300025246 Ga0209646_1000209 Ga0209646_100020944 277
63 3300031731 Ga0307405_10116483 Ga0307405_101164832 277
64 3300031901 Ga0307406_10001587 Ga0307406_1000158711 277
65 3300031901 Ga0307406_10044275 Ga0307406_100442752 277
66 3300044765 Ga0466970_0010516 Ga0466970_0010516_844_1686 277
67 3300044765 Ga0466970_0128791 Ga0466970_0128791_443_1285 277
68 3300046453 Ga0495627_000645 Ga0495627_000645_20860_21699 277
69 3300046543 Ga0495645_0030188 Ga0495645_0030188_2310_3179 277
70 3300048905 Ga0496102_0120247 Ga0496102_0120247_1486_2328 277
71 3300048917 Ga0496114_0014184 Ga0496114_0014184_373_1242 277
72 3300048917 Ga0496114_0133304 Ga0496114_0133304_488_1357 277
73 3300048920 Ga0496117_0001396 Ga0496117_0001396_22402_23244 277
74 3300048920 Ga0496117_0001427 Ga0496117_0001427_1046_1885 277
75 3300048921 Ga0496118_0000240 Ga0496118_0000240_5003_5845 277
76 3300048921 Ga0496118_0098227 Ga0496118_0098227_924_1763 277
77 3300048922 Ga0496119_0061816 Ga0496119_0061816_1124_1966 277
78 3300048923 Ga0496120_0175124 Ga0496120_0175124_66_908 277
79 3300048925 Ga0496122_0145195 Ga0496122_0145195_197_1036 277
80 3300048926 Ga0496123_0038971 Ga0496123_0038971_1342_2184 277
81 3300048927 Ga0496124_0000070 Ga0496124_0000070_144682_145524 277
82 3300048927 Ga0496124_0062500 Ga0496124_0062500_497_1339 277
83 3300048927 Ga0496124_0090295 Ga0496124_0090295_1093_1935 277
84 3300048927 Ga0496124_0142709 Ga0496124_0142709_373_1212 277
85 3300048928 Ga0496125_0005563 Ga0496125_0005563_8321_9160 277
86 3300048928 Ga0496125_0022517 Ga0496125_0022517_4970_5809 277
87 3300048928 Ga0496125_0086921 Ga0496125_0086921_683_1522 277
88 3300048929 Ga0496126_0004323 Ga0496126_0004323_3962_4801 277
89 3300049571 Ga0501034_0000550 Ga0501034_0000550_17113_17952 277
90 iso_pu_bacteria 2974294766 2974298165 277
91 iso_pu_bacteria 2974324384 2974325600 277
92 3300005367 Ga0070667_100199526 Ga0070667_1001995262 278
93 3300025986 Ga0207658_10226857 Ga0207658_102268572 278
94 3300031995 Ga0307409_100583743 Ga0307409_1005837431 278
95 3300041451 Ga0451791_1726022 Ga0451791_1726022_157_1002 278
96 3300053098 Ga0500650_0006916 Ga0500650_0006916_1465_2310 278
97 3300053136 Ga0500559_0005680 Ga0500559_0005680_4517_5365 278
98 3300053136 Ga0500559_0175978 Ga0500559_0175978_110_958 278
99 3300053140 Ga0500573_0003287 Ga0500573_0003287_1164_2009 278
100 3300048927 Ga0496124_0082174 Ga0496124_0082174_665_1534 279
101 3300053136 Ga0500559_0000319 Ga0500559_0000319_9072_9920 279
102 3300053140 Ga0500573_0000001 Ga0500573_0000001_13847_14695 279
103 iso_pu_bacteria 2984580707 2984582151 279
104 3300006038 Ga0075365_10067455 Ga0075365_100674552 280
105 3300006051 Ga0075364_10002439 Ga0075364_100024397 280
106 3300006186 Ga0075369_10000835 Ga0075369_100008359 280
107 3300013250 Ga0171462_1001 Ga0171462_1001402 280
108 3300013307 Ga0157372_10014043 Ga0157372_100140438 280
109 3300025728 Ga0207655_1040981 Ga0207655_10409812 280
110 3300031548 Ga0307408_100222485 Ga0307408_1002224852 280
111 3300031901 Ga0307406_10000126 Ga0307406_1000012634 280
112 3300031901 Ga0307406_10305504 Ga0307406_103055042 280
113 3300031995 Ga0307409_100259180 Ga0307409_1002591802 280
114 3300041512 Ga0451853_1038751 Ga0451853_1038751_120_968 280
115 3300044683 Ga0466965_0015806 Ga0466965_0015806_1688_2536 280
116 3300046694 Ga0495649_0141420 Ga0495649_0141420_360_1238 280
117 3300048903 Ga0496100_0031461 Ga0496100_0031461_2252_3100 280
118 3300048908 Ga0496105_0194040 Ga0496105_0194040_572_1420 280
119 3300048910 Ga0496107_0011280 Ga0496107_0011280_5211_6059 280
120 3300048911 Ga0496108_0122304 Ga0496108_0122304_535_1383 280
121 3300048913 Ga0496110_0085937 Ga0496110_0085937_970_1818 280
122 3300048914 Ga0496111_0151434 Ga0496111_0151434_270_1118 280
123 3300048919 Ga0496116_0077050 Ga0496116_0077050_271_1149 280
124 3300048921 Ga0496118_0007542 Ga0496118_0007542_3117_3995 280
125 3300048921 Ga0496118_0026277 Ga0496118_0026277_745_1668 280
126 3300048922 Ga0496119_0001581 Ga0496119_0001581_12804_13652 280
127 3300048922 Ga0496119_0003987 Ga0496119_0003987_12389_13237 280
128 3300048922 Ga0496119_0011696 Ga0496119_0011696_1045_1941 280
129 3300048922 Ga0496119_0019397 Ga0496119_0019397_974_1822 280
130 3300048922 Ga0496119_0072824 Ga0496119_0072824_634_1482 280
131 3300048923 Ga0496120_0000697 Ga0496120_0000697_27263_28111 280
132 3300048923 Ga0496120_0002616 Ga0496120_0002616_12911_13759 280
133 3300048923 Ga0496120_0003470 Ga0496120_0003470_11500_12378 280
134 3300048925 Ga0496122_0000020 Ga0496122_0000020_266356_267234 280
135 3300048925 Ga0496122_0016521 Ga0496122_0016521_2913_3761 280
136 3300048925 Ga0496122_0108965 Ga0496122_0108965_54_932 280
137 3300048925 Ga0496122_0123303 Ga0496122_0123303_329_1282 280
138 3300048926 Ga0496123_0000003 Ga0496123_0000003_481480_482358 280
139 3300048926 Ga0496123_0000718 Ga0496123_0000718_8395_9243 280
140 3300048927 Ga0496124_0006293 Ga0496124_0006293_11540_12388 280
141 3300048928 Ga0496125_0002974 Ga0496125_0002974_3605_4453 280
142 3300048928 Ga0496125_0016805 Ga0496125_0016805_6084_6962 280
143 3300048929 Ga0496126_0014147 Ga0496126_0014147_4555_5403 280
144 3300049574 Ga0501038_0225591 Ga0501038_0225591_621_1469 280
145 3300049575 Ga0501039_0128521 Ga0501039_0128521_489_1385 280
146 3300049586 Ga0501070_0000372 Ga0501070_0000372_17167_18045 280
147 3300050492 nmdc:mga0yw44_99444_c1 nmdc:mga0yw44_99444_c1_23_901 280
148 3300050516 nmdc:mga0sz30_104705_c1 nmdc:mga0sz30_104705_c1_341_1219 280
149 iso_pu_bacteria 2585428157 2588106845 280
150 iso_pu_bacteria 2643221566 2643846450 280
151 iso_pu_bacteria 2643221575 2643888398 280
152 iso_pu_bacteria 2773857763 2774400361 280
153 iso_pu_bacteria 2808606447 2809226731 280
154 iso_pu_bacteria 8045830549 8045832852 280
155 3300005366 Ga0070659_100048935 Ga0070659_1000489352 281
156 3300005539 Ga0068853_100036750 Ga0068853_1000367502 281
157 3300025932 Ga0207690_10261123 Ga0207690_102611232 281
158 iso_pu_bacteria 2808606306 2808631882 283
159 3300003578 Ga0006562J51391_1060070 Ga0006562J51391_106007012 284
160 3300003578 Ga0006562J51391_1060071 Ga0006562J51391_10600711 284

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03372

Exo_endo_phos

Endonuclease/Exonuclease/phosphatase family

18

278

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6lpm-assembly1.cif.gz_A crystal structure of ap endonuclease from deinococcus radioduran 0.8693 3 278
6lpm-assembly1.cif.gz_A crystal structure of ap endonuclease from deinococcus radioduran 0.8628 3 278
8igi-assembly2.cif.gz_B crystal structure of hp1526 (xtha)- a base excision dna repair protein in helicobacter pylori 0.859 5 276
4b5h-assembly1.cif.gz_A substate bound inactive mutant of neisseria ap endonuclease in presence of metal ions 0.8519 5 276
5cfe-assembly1.cif.gz_A bacillus subtilis ap endonuclease exoa 0.8516 6 278
ID Description Score Start End Superfamily
4up8A01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8974 95 110 2.40.50.140
4b5gC00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.8548 5 281 3.60.10.10
5cfeA00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.8516 6 278 3.60.10.10
3g3cB00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.8501 3 278 3.60.10.10
4b5gC00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.8487 5 281 3.60.10.10
ID Description Score Start End GO Terms
AF-A0A5N7UZH7-F1-model_v4 deleted 0.9671 5 153
AF-A0A7X6EM92-F1-model_v4 deleted 0.9547 67 167
AF-A0A3C1KDL8-F1-model_v4 Exodeoxyribonuclease III 0.9469 1 108 GO:0003824
AF-A0A349CZS5-F1-model_v4 Exodeoxyribonuclease III 0.9461 1 197 GO:0006281
GO:0008311
GO:0046872
AF-A0A4P7FJ56-F1-model_v4 deleted 0.943 1 87

Feature Viewer

pLDDT pTM Quality
86.42 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map