F235007

General Info

Members Datasets Scaffolds Average Seq Length
160 130 320 169

Family's Representative Sequence

Representative Sequence 3300032005|Ga0307411_10897497|Ga0307411_108974971
Length 201
Sequence MPHDTGGAGLAEPVAARAPRPSASTFLSGRARIRXXVNDREHEVDCDLRTSLLDLLRETLKLPGTKKGCNQGACGACTVLVDGERINACLALAVQYQGRSVTTIEGLASNDRMHPLQEAFIEHDGFQCGYCTPGQICSAIGMAGEVARGVPSAVTSDLSSGTMELSHDELRERMSGNLCRCGAHNGIVKAIQTHFASKDRP

Samples

Sample ID Description Type Environment
1 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
8 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
24 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
25 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
34 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
35 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
36 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
37 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
56 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
57 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
58 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
59 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
60 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
61 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
62 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
63 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
64 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
65 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
66 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
67 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
68 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
69 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
70 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
71 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
72 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
73 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
74 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
75 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
76 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
77 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
78 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
79 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
80 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
81 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
82 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
83 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
84 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
85 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
86 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
87 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
88 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
89 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
90 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
91 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
92 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
93 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
94 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
95 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
96 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
97 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
98 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
99 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
100 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
101 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
102 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
103 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
104 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
105 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
106 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
107 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
108 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
109 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
110 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
111 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
112 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
113 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
114 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
115 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
116 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
117 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
118 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
119 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
120 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
121 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
122 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
123 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
124 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
125 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
126 2738541307 Variovorax sp. GV008 Isolate Unclassified
127 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
128 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
129 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
130 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.88
Metatranscriptomes 0
Isolates 3.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.5
Nodule 0
Rhizoplane 4.38
Rhizosphere 63.75
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307411_10897497 3300032005 Bacteria 787
2 JGI24736J21556_1010581 3300001904 Bacteria 1505
3 JGI24739J22299_10014976 3300001989 Bacteria 2820
4 JGI24739J22299_10055661 3300001989 Bacteria 1264
5 JGI24737J22298_10039164 3300001990 Bacteria 1458
6 JGI24735J21928_10121133 3300002067 Bacteria 753
7 rootL2_10122983 3300003322 Bacteria 1568
8 Ga0055534_1020832 3300003784 Bacteria 1103
9 Ga0055540_1023941 3300003792 Bacteria 1527
10 Ga0070666_10173426 3300005335 Bacteria 1511
11 Ga0070668_100022759 3300005347 Bacteria 4738
12 Ga0070671_100337001 3300005355 Bacteria 1286
13 Ga0070659_100607093 3300005366 Bacteria 941
14 Ga0070714_100031428 3300005435 Bacteria 4429
15 Ga0070713_100564856 3300005436 Bacteria 1078
16 Ga0070711_100019097 3300005439 Bacteria 4391
17 Ga0070662_100046333 3300005457 Bacteria 3124
18 Ga0070707_101069347 3300005468 Bacteria 773
19 Ga0070679_100073081 3300005530 Bacteria 3422
20 Ga0070665_100427333 3300005548 Bacteria 1334
21 Ga0068859_100003057 3300005617 Bacteria 16982
22 Ga0068862_100042686 3300005844 Bacteria 3864
23 Ga0070717_10004784 3300006028 Bacteria 9846
24 Ga0075362_10210944 3300006177 Bacteria 947
25 Ga0075366_10742353 3300006195 Bacteria 610
26 Ga0097620_100003057 3300006931 Bacteria 16982
27 Ga0105240_10682183 3300009093 Bacteria 1123
28 Ga0105240_10795177 3300009093 Bacteria 1025
29 Ga0105245_10138546 3300009098 Bacteria 2289
30 Ga0105243_11211660 3300009148 Bacteria 768
31 Ga0105248_10009015 3300009177 Bacteria 10970
32 Ga0105248_10095759 3300009177 Bacteria 3342
33 Ga0105237_10912400 3300009545 Bacteria 885
34 Ga0157373_10009301 3300013100 Bacteria 7265
35 Ga0157372_11312999 3300013307 Bacteria 835
36 Ga0157379_10547180 3300014968 Bacteria 1077
37 Ga0163161_10045542 3300017792 Bacteria 3164
38 Ga0213875_10010744 3300021388 Bacteria 4578
39 Ga0209675_1004821 3300025291 Bacteria 5851
40 Ga0209050_1027062 3300025298 Bacteria 1901
41 Ga0209051_1002444 3300025303 Bacteria 13327
42 Ga0209051_1047170 3300025303 Bacteria 1474
43 Ga0209257_1072173 3300025304 Bacteria 906
44 Ga0207680_10182586 3300025903 Bacteria 1420
45 Ga0207647_10001538 3300025904 Bacteria 17767
46 Ga0207695_10992723 3300025913 Bacteria 719
47 Ga0207652_10153048 3300025921 Bacteria 2066
48 Ga0207700_10056170 3300025928 Bacteria 2963
49 Ga0207644_10275238 3300025931 Bacteria 1350
50 Ga0207690_10132839 3300025932 Bacteria 1824
51 Ga0207706_10014114 3300025933 Bacteria 7244
52 Ga0207711_10006293 3300025941 Bacteria 10014
53 Ga0207711_10207507 3300025941 Bacteria 1789
54 Ga0207689_10328220 3300025942 Bacteria 1270
55 Ga0207668_10000912 3300025972 Bacteria 17798
56 Ga0207674_11607572 3300026116 Bacteria 618
57 Ga0207683_11457341 3300026121 Bacteria 632
58 Ga0268266_10365440 3300028379 Bacteria 1358
59 Ga0268265_10022907 3300028380 Bacteria 4396
60 Ga0307515_10005957 3300028794 Bacteria 24557
61 Ga0307515_10063837 3300028794 Bacteria 5162
62 Ga0265327_10000186 3300031251 Bacteria 131420
63 Ga0307509_10847740 3300031507 Bacteria 578
64 Ga0307508_10622868 3300031616 Bacteria 682
65 Ga0307412_10264896 3300031911 Bacteria 1342
66 Ga0373924_0025350 3300035410 Bacteria 2345
67 Ga0373937_0119701 3300036401 Bacteria 2453
68 Ga0395899_0044844 3300037312 Bacteria 3294
69 Ga0436364_0471524 3300037853 Bacteria 6420
70 Ga0436363_0214710 3300039450 Bacteria 1050
71 Ga0436363_1522987 3300039450 Bacteria 1712
72 Ga0436362_1187003 3300039453 Bacteria 1288
73 Ga0439448_0007021 3300042005 Bacteria 3251
74 Ga0439448_0027083 3300042005 Bacteria 1805
75 Ga0439454_040874 3300042011 Bacteria 758
76 Ga0439455_0009081 3300042012 Bacteria 2148
77 Ga0439455_0046600 3300042012 Bacteria 1123
78 Ga0439458_0002135 3300042157 Bacteria 4886
79 Ga0439458_0005292 3300042157 Bacteria 2903
80 Ga0466965_0119630 3300044683 Bacteria 1359
81 Ga0495627_000345 3300046453 Bacteria 43727
82 Ga0495651_0066370 3300046462 Bacteria 2754
83 Ga0495651_0130062 3300046462 Bacteria 1839
84 Ga0495650_0000857 3300046471 Bacteria 36524
85 Ga0495607_0044194 3300046501 Bacteria 2628
86 Ga0495583_0023026 3300046506 Bacteria 3161
87 Ga0495606_0024435 3300046507 Bacteria 4354
88 Ga0495608_0104264 3300046511 Bacteria 1826
89 Ga0495610_0000778 3300046512 Bacteria 29999
90 Ga0495618_0350673 3300046514 Bacteria 910
91 Ga0495620_0016103 3300046515 Bacteria 3762
92 Ga0495630_0753363 3300046517 Bacteria 744
93 Ga0495632_0000835 3300046519 Bacteria 27152
94 Ga0495643_0000048 3300046522 Bacteria 212788
95 Ga0495643_0011729 3300046522 Bacteria 5319
96 Ga0495643_0071520 3300046522 Bacteria 1820
97 Ga0495648_0148545 3300046524 Bacteria 1225
98 Ga0495652_0108801 3300046529 Bacteria 2233
99 Ga0495640_0286504 3300046533 Bacteria 1025
100 Ga0495587_0145455 3300046536 Bacteria 1352
101 Ga0495609_0004356 3300046538 Bacteria 7776
102 Ga0495667_0152161 3300046559 Bacteria 1489
103 Ga0495625_0015141 3300046660 Bacteria 6120
104 Ga0495657_0005263 3300046675 Bacteria 10240
105 Ga0495599_0075416 3300046678 Bacteria 2106
106 Ga0495646_0090805 3300046680 Bacteria 1764
107 Ga0495600_0010905 3300046809 Bacteria 5652
108 Ga0495604_0008845 3300047317 Bacteria 7959
109 Ga0495674_0167043 3300047319 Bacteria 1838
110 Ga0495680_0016447 3300047322 Bacteria 6352
111 Ga0495675_0171421 3300047444 Bacteria 1333
112 Ga0495681_0000434 3300047470 Bacteria 32061
113 Ga0495681_0028866 3300047470 Bacteria 2848
114 Ga0495681_0232570 3300047470 Bacteria 735
115 Ga0495686_0000244 3300047472 Bacteria 98321
116 Ga0495686_0007142 3300047472 Bacteria 8410
117 Ga0496104_0202215 3300048907 Bacteria 1898
118 Ga0496105_0012389 3300048908 Bacteria 6752
119 Ga0496108_0709112 3300048911 Bacteria 872
120 Ga0496108_0745811 3300048911 Bacteria 847
121 Ga0496108_0806675 3300048911 Bacteria 810
122 Ga0496113_0100811 3300048916 Bacteria 2238
123 Ga0496113_0118818 3300048916 Bacteria 2065
124 Ga0496117_0009288 3300048920 Bacteria 9186
125 Ga0496117_0032455 3300048920 Bacteria 3966
126 Ga0496117_0067084 3300048920 Bacteria 2430
127 Ga0496117_0088907 3300048920 Bacteria 1997
128 Ga0496118_0000434 3300048921 Bacteria 69469
129 Ga0496118_0021522 3300048921 Bacteria 5671
130 Ga0496118_0258256 3300048921 Bacteria 985
131 Ga0496121_0014306 3300048924 Bacteria 8436
132 Ga0496121_0018202 3300048924 Bacteria 7100
133 Ga0496121_0057771 3300048924 Bacteria 3213
134 Ga0496121_0264345 3300048924 Bacteria 1186
135 Ga0496121_0411183 3300048924 Bacteria 883
136 Ga0496122_0209598 3300048925 Bacteria 1130
137 Ga0496123_0065758 3300048926 Bacteria 2302
138 Ga0496124_0001561 3300048927 Bacteria 33105
139 Ga0496124_0082023 3300048927 Bacteria 2648
140 Ga0496124_0131917 3300048927 Bacteria 1984
141 Ga0496125_0235658 3300048928 Bacteria 1166
142 Ga0495678_010403 3300049459 Bacteria 4526
143 nmdc:mga0yw44_696593_c1 3300050492 Bacteria 690
144 nmdc:mga07m45_51573_c1 3300050496 Bacteria 1294
145 Ga0495601_0090439 3300053077 Bacteria 1969
146 Ga0495595_0032169 3300053084 Bacteria 2361
147 Ga0500643_001445 3300053087 Bacteria 13680
148 Ga0500646_0074305 3300053090 Bacteria 1025
149 Ga0500641_0003274 3300053096 Bacteria 5728
150 Ga0500595_001047 3300053119 Bacteria 15408
151 Ga0500559_0000732 3300053136 Bacteria 21586
152 Ga0500573_0027103 3300053140 Bacteria 3294
153 Ga0500588_0002916 3300053146 Bacteria 3552
154 Ga0500637_0254209 3300053178 Bacteria 979
155 Ga0500599_007146 3300053736 Bacteria 1433
156 2738881223 2738541307 Bacteria 8606193
157 2819553843 2818991438 Bacteria 5793701
158 2929203665 2929199973 Bacteria 7260745
159 8054306947 8054302542 Bacteria 5698134
160 8055911144 8055909800 Bacteria 7278581
161 Ga0307411_10897497
162 JGI24736J21556_1010581
163 JGI24739J22299_10014976
164 JGI24739J22299_10055661
165 JGI24737J22298_10039164
166 JGI24735J21928_10121133
167 rootL2_10122983
168 Ga0055534_1020832
169 Ga0055540_1023941
170 Ga0070666_10173426
171 Ga0070668_100022759
172 Ga0070671_100337001
173 Ga0070659_100607093
174 Ga0070714_100031428
175 Ga0070713_100564856
176 Ga0070711_100019097
177 Ga0070662_100046333
178 Ga0070707_101069347
179 Ga0070679_100073081
180 Ga0070665_100427333
181 Ga0068859_100003057
182 Ga0068862_100042686
183 Ga0070717_10004784
184 Ga0075362_10210944
185 Ga0075366_10742353
186 Ga0097620_100003057
187 Ga0105240_10682183
188 Ga0105240_10795177
189 Ga0105245_10138546
190 Ga0105243_11211660
191 Ga0105248_10009015
192 Ga0105248_10095759
193 Ga0105237_10912400
194 Ga0157373_10009301
195 Ga0157372_11312999
196 Ga0157379_10547180
197 Ga0163161_10045542
198 Ga0213875_10010744
199 Ga0209675_1004821
200 Ga0209050_1027062
201 Ga0209051_1002444
202 Ga0209051_1047170
203 Ga0209257_1072173
204 Ga0207680_10182586
205 Ga0207647_10001538
206 Ga0207695_10992723
207 Ga0207652_10153048
208 Ga0207700_10056170
209 Ga0207644_10275238
210 Ga0207690_10132839
211 Ga0207706_10014114
212 Ga0207711_10006293
213 Ga0207711_10207507
214 Ga0207689_10328220
215 Ga0207668_10000912
216 Ga0207674_11607572
217 Ga0207683_11457341
218 Ga0268266_10365440
219 Ga0268265_10022907
220 Ga0307515_10005957
221 Ga0307515_10063837
222 Ga0265327_10000186
223 Ga0307509_10847740
224 Ga0307508_10622868
225 Ga0307412_10264896
226 Ga0373924_0025350
227 Ga0373937_0119701
228 Ga0395899_0044844
229 Ga0436364_0471524
230 Ga0436363_0214710
231 Ga0436363_1522987
232 Ga0436362_1187003
233 Ga0439448_0007021
234 Ga0439448_0027083
235 Ga0439454_040874
236 Ga0439455_0009081
237 Ga0439455_0046600
238 Ga0439458_0002135
239 Ga0439458_0005292
240 Ga0466965_0119630
241 Ga0495627_000345
242 Ga0495651_0066370
243 Ga0495651_0130062
244 Ga0495650_0000857
245 Ga0495607_0044194
246 Ga0495583_0023026
247 Ga0495606_0024435
248 Ga0495608_0104264
249 Ga0495610_0000778
250 Ga0495618_0350673
251 Ga0495620_0016103
252 Ga0495630_0753363
253 Ga0495632_0000835
254 Ga0495643_0000048
255 Ga0495643_0011729
256 Ga0495643_0071520
257 Ga0495648_0148545
258 Ga0495652_0108801
259 Ga0495640_0286504
260 Ga0495587_0145455
261 Ga0495609_0004356
262 Ga0495667_0152161
263 Ga0495625_0015141
264 Ga0495657_0005263
265 Ga0495599_0075416
266 Ga0495646_0090805
267 Ga0495600_0010905
268 Ga0495604_0008845
269 Ga0495674_0167043
270 Ga0495680_0016447
271 Ga0495675_0171421
272 Ga0495681_0000434
273 Ga0495681_0028866
274 Ga0495681_0232570
275 Ga0495686_0000244
276 Ga0495686_0007142
277 Ga0496104_0202215
278 Ga0496105_0012389
279 Ga0496108_0709112
280 Ga0496108_0745811
281 Ga0496108_0806675
282 Ga0496113_0100811
283 Ga0496113_0118818
284 Ga0496117_0009288
285 Ga0496117_0032455
286 Ga0496117_0067084
287 Ga0496117_0088907
288 Ga0496118_0000434
289 Ga0496118_0021522
290 Ga0496118_0258256
291 Ga0496121_0014306
292 Ga0496121_0018202
293 Ga0496121_0057771
294 Ga0496121_0264345
295 Ga0496121_0411183
296 Ga0496122_0209598
297 Ga0496123_0065758
298 Ga0496124_0001561
299 Ga0496124_0082023
300 Ga0496124_0131917
301 Ga0496125_0235658
302 Ga0495678_010403
303 nmdc:mga0yw44_696593_c1
304 nmdc:mga07m45_51573_c1
305 Ga0495601_0090439
306 Ga0495595_0032169
307 Ga0500643_001445
308 Ga0500646_0074305
309 Ga0500641_0003274
310 Ga0500595_001047
311 Ga0500559_0000732
312 Ga0500573_0027103
313 Ga0500588_0002916
314 Ga0500637_0254209
315 Ga0500599_007146
316 2738881223
317 2819553843
318 2929203665
319 8054306947
320 8055911144

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

103

192

0.94

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

35

96

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5g5h-assembly1.cif.gz_A escherichia coli periplasmic aldehyde oxidase r440h mutant 0.9567 1 161
5y6q-assembly1.cif.gz_A crystal structure of an aldehyde oxidase from methylobacillus sp. ky4400 0.9287 1 161
4zoh-assembly1.cif.gz_C-2 crystal structure of glyceraldehyde oxidoreductase 0.9204 2 160
1n5w-assembly1.cif.gz_D crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.9176 1 160
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9138 1 160
ID Description Score Start End Superfamily
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9428 1 74 3.10.20.30
1n5wA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9376 1 74 3.10.20.30
5g5hA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9295 76 161 1.10.150.120
3hrdH01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9147 1 74 3.10.20.30
af_Q46801_1_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9142 1 71 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A2U1XWY2-F1-model_v4 2Fe-2S ferredoxin-type domain-containing protein 0.9707 1 164 GO:0016903
GO:0046872
GO:0051537
AF-A0A520HE77-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.9694 1 164 GO:0016903
GO:0046872
GO:0051537
AF-A0A3N5M0A3-F1-model_v4 (2Fe-2S)-binding protein 0.969 1 164 GO:0016903
GO:0046872
GO:0051537
AF-A0A2W1YVG3-F1-model_v4 deleted 0.9683 2 161
AF-A0A1Q7Y6I8-F1-model_v4 (2Fe-2S)-binding protein 0.9678 2 164 GO:0016903
GO:0046872
GO:0051537

Map