F234860

General Info

Members Datasets Scaffolds Average Seq Length
160 73 320 154

Family's Representative Sequence

Representative Sequence 3300028573|Ga0265334_10020505|Ga0265334_100205053
Length 160
Sequence MKVFSEVTPFDFGGPAANEIVLPQGIIGFAQYRRAELLYMPDHLPFLWMRLHRTDISNRSDSVHFIVLEPGGVIADYEPEIFDEDAEQLGITDPSEAMILNIVTLRQQQPVEASINLVGPVIVNRRTRTGRQLVISNYSLYSAHYQLVDCAPASAQARIA

Samples

Sample ID Description Type Environment
1 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
8 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
9 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
10 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
11 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
12 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
13 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
14 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
15 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
16 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
20 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
21 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
22 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
23 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
24 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
25 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
26 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
27 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
28 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
29 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
30 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
31 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
32 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
33 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
34 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
35 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
36 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
37 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
38 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
39 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
40 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
41 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
42 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
43 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
44 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
45 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
46 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
47 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
48 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
49 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
50 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
51 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
52 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
53 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
54 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
55 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
56 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
57 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
58 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
59 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
60 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
61 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
62 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
63 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
64 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
65 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
66 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
67 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
68 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
69 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
70 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
71 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
72 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
73 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.38
Metatranscriptomes 0.62
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.25
Nodule 0
Rhizoplane 0
Rhizosphere 93.75
Stem 0
Stem Tuber 0
Unclassified 23.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265334_10020505 3300028573 Bacteria 2706
2 rootH2_10000474 3300003320 Bacteria 14354
3 rootL2_10058279 3300003322 Bacteria 9953
4 rootL2_10143382 3300003322 Bacteria 3491
5 rootL2_10249487 3300003322 Unclassified 4179
6 Ga0070658_10055351 3300005327 Bacteria 3223
7 Ga0070683_100006938 3300005329 Bacteria 9521
8 Ga0068868_100133481 3300005338 Unclassified 2033
9 Ga0070679_100138643 3300005530 Bacteria 2413
10 Ga0068856_100019531 3300005614 Bacteria 6578
11 Ga0068852_101501015 3300005616 Unclassified 696
12 Ga0075366_10335316 3300006195 Bacteria 927
13 Ga0068865_100954736 3300006881 Bacteria 748
14 Ga0105240_11831633 3300009093 Unclassified 632
15 Ga0105249_11035114 3300009553 Unclassified 890
16 Ga0157369_10226259 3300013105 Bacteria 1957
17 Ga0163163_10347303 3300014325 Bacteria 1539
18 Ga0207705_10043207 3300025909 Bacteria 3237
19 Ga0207652_10035236 3300025921 Bacteria 4223
20 Ga0207712_10871384 3300025961 Unclassified 794
21 Ga0207702_10127129 3300026078 Bacteria 2290
22 Ga0207674_10901054 3300026116 Bacteria 852
23 Ga0265337_1005108 3300028556 Bacteria 5281
24 Ga0265337_1039738 3300028556 Unclassified 1359
25 Ga0265337_1088514 3300028556 Bacteria 845
26 Ga0265319_1000008 3300028563 Bacteria 215029
27 Ga0265319_1004149 3300028563 Bacteria 7266
28 Ga0265319_1007892 3300028563 Bacteria 4728
29 Ga0265319_1009049 3300028563 Bacteria 4293
30 Ga0265319_1009213 3300028563 Bacteria 4229
31 Ga0265319_1032604 3300028563 Bacteria 1804
32 Ga0265319_1254437 3300028563 Unclassified 535
33 Ga0265334_10001839 3300028573 Bacteria 10095
34 Ga0265318_10000047 3300028577 Bacteria 123944
35 Ga0265318_10011508 3300028577 Unclassified 3805
36 Ga0265318_10020617 3300028577 Unclassified 2658
37 Ga0265318_10031371 3300028577 Bacteria 2061
38 Ga0265323_10000014 3300028653 Bacteria 106540
39 Ga0265323_10003844 3300028653 Bacteria 6544
40 Ga0265323_10013135 3300028653 Unclassified 3311
41 Ga0265323_10013800 3300028653 Bacteria 3213
42 Ga0265323_10018399 3300028653 Unclassified 2703
43 Ga0265323_10034783 3300028653 Bacteria 1860
44 Ga0265323_10045664 3300028653 Bacteria 1573
45 Ga0265323_10144403 3300028653 Unclassified 764
46 Ga0265323_10192520 3300028653 Bacteria 643
47 Ga0265322_10000225 3300028654 Bacteria 24887
48 Ga0307515_10585223 3300028794 Unclassified 726
49 Ga0265338_10143923 3300028800 Bacteria 1863
50 Ga0265338_10422880 3300028800 Unclassified 947
51 Ga0265330_10003838 3300031235 Bacteria 7738
52 Ga0265330_10037113 3300031235 Unclassified 2170
53 Ga0265328_10211354 3300031239 Bacteria 738
54 Ga0265320_10003100 3300031240 Bacteria 11281
55 Ga0265320_10004985 3300031240 Bacteria 8607
56 Ga0265320_10006116 3300031240 Bacteria 7624
57 Ga0265320_10017433 3300031240 Bacteria 3986
58 Ga0265320_10033922 3300031240 Bacteria 2602
59 Ga0265320_10037207 3300031240 Unclassified 2452
60 Ga0265320_10046840 3300031240 Bacteria 2116
61 Ga0265320_10061734 3300031240 Bacteria 1786
62 Ga0265320_10116231 3300031240 Bacteria 1223
63 Ga0265320_10143829 3300031240 Bacteria 1079
64 Ga0265325_10316532 3300031241 Bacteria 694
65 Ga0265339_10025719 3300031249 Unclassified 3375
66 Ga0265339_10102450 3300031249 Unclassified 1488
67 Ga0265331_10003973 3300031250 Bacteria 9343
68 Ga0265331_10031680 3300031250 Bacteria 2626
69 Ga0265327_10000023 3300031251 Bacteria 382703
70 Ga0265327_10002072 3300031251 Bacteria 22412
71 Ga0265327_10002294 3300031251 Bacteria 20511
72 Ga0265327_10010217 3300031251 Bacteria 6629
73 Ga0265327_10301538 3300031251 Bacteria 705
74 Ga0265316_10004515 3300031344 Bacteria 13830
75 Ga0265316_10033238 3300031344 Unclassified 4203
76 Ga0265316_10071054 3300031344 Bacteria 2684
77 Ga0265316_10316670 3300031344 Unclassified 1134
78 Ga0265313_10001310 3300031595 Bacteria 23450
79 Ga0265313_10003055 3300031595 Bacteria 13890
80 Ga0265313_10003165 3300031595 Bacteria 13587
81 Ga0265313_10003544 3300031595 Bacteria 12582
82 Ga0265313_10008295 3300031595 Bacteria 6925
83 Ga0265313_10153168 3300031595 Bacteria 983
84 Ga0307508_10000599 3300031616 Bacteria 43133
85 Ga0265314_10001116 3300031711 Bacteria 31014
86 Ga0265314_10003872 3300031711 Bacteria 14251
87 Ga0265314_10003922 3300031711 Bacteria 14133
88 Ga0265314_10062092 3300031711 Bacteria 2541
89 Ga0265342_10011524 3300031712 Bacteria 6045
90 Ga0265342_10044913 3300031712 Bacteria 2661
91 Ga0265342_10046264 3300031712 Bacteria 2616
92 Ga0265342_10077034 3300031712 Bacteria 1932
93 Ga0307516_10427617 3300031730 Bacteria 982
94 Ga0373941_0313925 3300035115 Unclassified 629
95 Ga0373931_0156146 3300035691 Bacteria 1334
96 Ga0373935_0236699 3300035692 Unclassified 1273
97 Ga0395905_0242294 3300037471 Unclassified 1685
98 Ga0451841_0958964 3300041498 Unclassified 588
99 Ga0439431_0121361 3300041997 Bacteria 729
100 Ga0451577_0100128 3300042876 Bacteria 2589
101 Ga0451577_1132679 3300042876 Bacteria 699
102 Ga0451577_1289440 3300042876 Unclassified 650
103 Ga0466969_0235365 3300044656 Unclassified 832
104 Ga0453683_0002220 3300044673 Bacteria 15378
105 Ga0453683_0008579 3300044673 Bacteria 6855
106 Ga0453684_0021953 3300044712 Bacteria 9500
107 Ga0453684_0070966 3300044712 Bacteria 4407
108 Ga0453684_0084350 3300044712 Unclassified 3951
109 Ga0453684_0137379 3300044712 Bacteria 2924
110 Ga0453684_0182928 3300044712 Bacteria 2459
111 Ga0453684_0816052 3300044712 Bacteria 1005
112 Ga0466959_0095671 3300045049 Unclassified 2130
113 Ga0451576_0001856 3300045051 Bacteria 34183
114 Ga0451576_0009969 3300045051 Bacteria 10956
115 Ga0451576_0010287 3300045051 Bacteria 10746
116 Ga0451576_0040448 3300045051 Bacteria 4934
117 Ga0451576_0145436 3300045051 Bacteria 2472
118 Ga0451576_2597547 3300045051 Bacteria 516
119 Ga0501308_001235 3300049128 Bacteria 1989
120 Ga0501031_0259446 3300049568 Unclassified 1129
121 Ga0501032_0000162 3300049569 Bacteria 54186
122 Ga0501032_0003202 3300049569 Bacteria 12595
123 Ga0501033_0000884 3300049570 Bacteria 27376
124 Ga0501033_0074912 3300049570 Bacteria 2484
125 Ga0501034_0438871 3300049571 Bacteria 1224
126 Ga0501036_0552657 3300049572 Unclassified 957
127 Ga0501037_0003437 3300049573 Bacteria 11512
128 Ga0501037_0133414 3300049573 Unclassified 1779
129 Ga0501038_0008307 3300049574 Bacteria 9556
130 Ga0501039_0076601 3300049575 Bacteria 2600
131 Ga0501043_0118572 3300049579 Bacteria 2075
132 Ga0501043_0523013 3300049579 Bacteria 884
133 Ga0501046_0007931 3300049580 Bacteria 9295
134 Ga0501046_0013060 3300049580 Bacteria 7048
135 Ga0501046_0017818 3300049580 Bacteria 5923
136 Ga0501046_0034916 3300049580 Bacteria 4055
137 Ga0501046_0233080 3300049580 Bacteria 1359
138 Ga0501047_0004386 3300049581 Bacteria 13279
139 Ga0501047_0004403 3300049581 Bacteria 13258
140 Ga0501047_0017286 3300049581 Bacteria 6906
141 Ga0501047_0026092 3300049581 Bacteria 5619
142 Ga0501047_0050114 3300049581 Bacteria 4032
143 Ga0501048_0796231 3300049582 Unclassified 679
144 Ga0501216_098790 3300049660 Unclassified 641
145 Ga0501083_0023855 3300049744 Bacteria 4242
146 Ga0501269_033186 3300049766 Unclassified 668
147 Ga0501035_0003477 3300049822 Bacteria 15066
148 Ga0501035_0119774 3300049822 Bacteria 2302
149 Ga0501035_0128373 3300049822 Bacteria 2212
150 Ga0501035_0202956 3300049822 Unclassified 1699
151 Ga0501035_0232556 3300049822 Bacteria 1570
152 Ga0501035_0233548 3300049822 Bacteria 1566
153 Ga0501044_0000394 3300049823 Bacteria 54239
154 Ga0501044_0041963 3300049823 Bacteria 4762
155 Ga0501044_0134112 3300049823 Bacteria 2468
156 Ga0501044_0542693 3300049823 Bacteria 1060
157 Ga0501044_0596087 3300049823 Unclassified 998
158 Ga0501045_0184553 3300049824 Unclassified 1554
159 nmdc:mga0k408_425590_c1 3300050493 Bacteria 789
160 Ga0501082_0110053 3300060353 Bacteria 2385
161 Ga0265334_10020505
162 rootH2_10000474
163 rootL2_10058279
164 rootL2_10143382
165 rootL2_10249487
166 Ga0070658_10055351
167 Ga0070683_100006938
168 Ga0068868_100133481
169 Ga0070679_100138643
170 Ga0068856_100019531
171 Ga0068852_101501015
172 Ga0075366_10335316
173 Ga0068865_100954736
174 Ga0105240_11831633
175 Ga0105249_11035114
176 Ga0157369_10226259
177 Ga0163163_10347303
178 Ga0207705_10043207
179 Ga0207652_10035236
180 Ga0207712_10871384
181 Ga0207702_10127129
182 Ga0207674_10901054
183 Ga0265337_1005108
184 Ga0265337_1039738
185 Ga0265337_1088514
186 Ga0265319_1000008
187 Ga0265319_1004149
188 Ga0265319_1007892
189 Ga0265319_1009049
190 Ga0265319_1009213
191 Ga0265319_1032604
192 Ga0265319_1254437
193 Ga0265334_10001839
194 Ga0265318_10000047
195 Ga0265318_10011508
196 Ga0265318_10020617
197 Ga0265318_10031371
198 Ga0265323_10000014
199 Ga0265323_10003844
200 Ga0265323_10013135
201 Ga0265323_10013800
202 Ga0265323_10018399
203 Ga0265323_10034783
204 Ga0265323_10045664
205 Ga0265323_10144403
206 Ga0265323_10192520
207 Ga0265322_10000225
208 Ga0307515_10585223
209 Ga0265338_10143923
210 Ga0265338_10422880
211 Ga0265330_10003838
212 Ga0265330_10037113
213 Ga0265328_10211354
214 Ga0265320_10003100
215 Ga0265320_10004985
216 Ga0265320_10006116
217 Ga0265320_10017433
218 Ga0265320_10033922
219 Ga0265320_10037207
220 Ga0265320_10046840
221 Ga0265320_10061734
222 Ga0265320_10116231
223 Ga0265320_10143829
224 Ga0265325_10316532
225 Ga0265339_10025719
226 Ga0265339_10102450
227 Ga0265331_10003973
228 Ga0265331_10031680
229 Ga0265327_10000023
230 Ga0265327_10002072
231 Ga0265327_10002294
232 Ga0265327_10010217
233 Ga0265327_10301538
234 Ga0265316_10004515
235 Ga0265316_10033238
236 Ga0265316_10071054
237 Ga0265316_10316670
238 Ga0265313_10001310
239 Ga0265313_10003055
240 Ga0265313_10003165
241 Ga0265313_10003544
242 Ga0265313_10008295
243 Ga0265313_10153168
244 Ga0307508_10000599
245 Ga0265314_10001116
246 Ga0265314_10003872
247 Ga0265314_10003922
248 Ga0265314_10062092
249 Ga0265342_10011524
250 Ga0265342_10044913
251 Ga0265342_10046264
252 Ga0265342_10077034
253 Ga0307516_10427617
254 Ga0373941_0313925
255 Ga0373931_0156146
256 Ga0373935_0236699
257 Ga0395905_0242294
258 Ga0451841_0958964
259 Ga0439431_0121361
260 Ga0451577_0100128
261 Ga0451577_1132679
262 Ga0451577_1289440
263 Ga0466969_0235365
264 Ga0453683_0002220
265 Ga0453683_0008579
266 Ga0453684_0021953
267 Ga0453684_0070966
268 Ga0453684_0084350
269 Ga0453684_0137379
270 Ga0453684_0182928
271 Ga0453684_0816052
272 Ga0466959_0095671
273 Ga0451576_0001856
274 Ga0451576_0009969
275 Ga0451576_0010287
276 Ga0451576_0040448
277 Ga0451576_0145436
278 Ga0451576_2597547
279 Ga0501308_001235
280 Ga0501031_0259446
281 Ga0501032_0000162
282 Ga0501032_0003202
283 Ga0501033_0000884
284 Ga0501033_0074912
285 Ga0501034_0438871
286 Ga0501036_0552657
287 Ga0501037_0003437
288 Ga0501037_0133414
289 Ga0501038_0008307
290 Ga0501039_0076601
291 Ga0501043_0118572
292 Ga0501043_0523013
293 Ga0501046_0007931
294 Ga0501046_0013060
295 Ga0501046_0017818
296 Ga0501046_0034916
297 Ga0501046_0233080
298 Ga0501047_0004386
299 Ga0501047_0004403
300 Ga0501047_0017286
301 Ga0501047_0026092
302 Ga0501047_0050114
303 Ga0501048_0796231
304 Ga0501216_098790
305 Ga0501083_0023855
306 Ga0501269_033186
307 Ga0501035_0003477
308 Ga0501035_0119774
309 Ga0501035_0128373
310 Ga0501035_0202956
311 Ga0501035_0232556
312 Ga0501035_0233548
313 Ga0501044_0000394
314 Ga0501044_0041963
315 Ga0501044_0134112
316 Ga0501044_0542693
317 Ga0501044_0596087
318 Ga0501045_0184553
319 nmdc:mga0k408_425590_c1
320 Ga0501082_0110053

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02623

FliW

FliW protein

20

147

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2aj7-assembly1.cif.gz_A crystal structure of a putative contractile protein (bh3618) from bacillus halodurans at 1.67 a resolution 0.8983 20 147
2aj7-assembly1.cif.gz_B crystal structure of a putative contractile protein (bh3618) from bacillus halodurans at 1.67 a resolution 0.8937 20 144
5jak-assembly1.cif.gz_A crystal structure of the flagellar assembly factor fliw 0.8801 20 146
5dmb-assembly1.cif.gz_A crystal structure of a translational regulator bound to a flagellar assembly factor 0.8325 6 146
5dmb-assembly1.cif.gz_A crystal structure of a translational regulator bound to a flagellar assembly factor 0.8048 6 146
ID Description Score Start End Superfamily
af_Q9QZ05_1393_1492_3.40.50.800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.876 37 66 3.40.50.800
5dmbA00 Mainly Beta;Roll;BH3618-like;BH3618-like 0.8325 6 146 2.30.290.10
5dmbA00 Mainly Beta;Roll;BH3618-like;BH3618-like 0.8048 6 146 2.30.290.10
af_Q3S1L4_31_129_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.779 37 65 3.10.450.50
af_O62123_289_355_1.20.5.2050 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.7565 37 63 1.20.5.2050
ID Description Score Start End GO Terms
AF-A0A2A2QAB3-F1-model_v4 Flagellar assembly factor FliW 0.9719 16 148 GO:0005737
GO:0006417
GO:0044780
AF-A0A1G3Z7B7-F1-model_v4 Flagellar assembly factor FliW 0.9491 21 145 GO:0005737
GO:0006417
GO:0044780
AF-A0A212KWM0-F1-model_v4 Flagellar assembly factor FliW 0.9382 20 145 GO:0005737
GO:0006417
GO:0044780
AF-A0A2E7PSI8-F1-model_v4 Flagellar assembly factor FliW 0.9309 14 146 GO:0005737
GO:0006417
GO:0044780
AF-A0A3B8MEI1-F1-model_v4 Flagellar assembly factor FliW 0.9295 20 144 GO:0005737
GO:0006417
GO:0044780

Map