F234859

General Info

Members Datasets Scaffolds Average Seq Length
160 122 320 278

Family's Representative Sequence

Representative Sequence 3300028558|Ga0265326_10002267|Ga0265326_100022676
Length 310
Sequence METAGQEVGKIETPLRQLGTRIDRLVAKADAVGTTEHLTIGDNTIAYDLIGEGPLVVLAHGLGDSRHSYRFVAPALAAAGYRVASVDIRGCGDSSLGWYGYTRTDIAGDLVALVRHLGGPAVLIGHSVSGGAATIAAATAPDLVTGLIELAPFTLKQVNDLGGLVRVKRYRAGATLMARVALLGSLSAWKKYLELAYPVRPADWDGELARIEDKMREPGRMKALQAMCKSAADAGAQLPNVACAVLVIEGSADPDWADPSAEGERIIANLPQGLGQLVVIEGAGHYLHAQTPDQVVALALPFIAKTLIRA

Samples

Sample ID Description Type Environment
1 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
6 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
8 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
9 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
10 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
11 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
12 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
13 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
14 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
15 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
16 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
17 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
18 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
19 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
20 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
21 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
22 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
23 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
24 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
25 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
26 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
27 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
28 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
29 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
30 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
31 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
32 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
33 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
34 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
35 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
36 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
37 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
38 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
39 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
40 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
41 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
42 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
43 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
44 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
45 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
46 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
47 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
48 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
49 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
50 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
51 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
52 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
53 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
54 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
55 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
56 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
57 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
58 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
59 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
60 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
61 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
62 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
63 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
64 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
65 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
66 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
67 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
68 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
69 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
70 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
71 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
72 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
73 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
74 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
75 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
76 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
77 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
78 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
79 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
84 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
85 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
86 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
87 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
88 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
89 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
90 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
91 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
92 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
93 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
94 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
95 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
96 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
97 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
98 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
99 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
100 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
101 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
102 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
103 2858882152 Micromonospora noduli MED15 Isolate Nodule
104 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
105 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
106 2867369537 Streptomyces sp. Z26 Isolate Unclassified
107 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
108 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
109 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
110 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
111 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
112 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
113 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
114 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
115 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
116 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
117 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
118 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
119 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
120 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
121 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
122 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80
Metatranscriptomes 0
Isolates 20

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10
Nodule 3.12
Rhizoplane 1.88
Rhizosphere 66.25
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265326_10002267 3300028558 Bacteria 6512
2 rootL2_10119307 3300003322 Bacteria 2967
3 Ga0070683_100358355 3300005329 Bacteria 1389
4 Ga0070668_100008485 3300005347 Bacteria 7631
5 Ga0068855_100205606 3300005563 Bacteria 2215
6 Ga0081539_10005841 3300005985 Bacteria 12213
7 Ga0075365_10013554 3300006038 Bacteria 4882
8 Ga0075365_10103477 3300006038 Bacteria 1951
9 Ga0075365_10411227 3300006038 Bacteria 955
10 Ga0075364_10043977 3300006051 Bacteria 2903
11 Ga0075364_10051451 3300006051 Bacteria 2690
12 Ga0105245_10081574 3300009098 Bacteria 2957
13 Ga0157375_10298953 3300013308 Bacteria 1773
14 Ga0183367_1004 3300015688 Bacteria 716880
15 Ga0207652_10647268 3300025921 Bacteria 945
16 Ga0207668_10000579 3300025972 Bacteria 22887
17 Ga0207678_10595485 3300026067 Bacteria 969
18 Ga0207683_10468537 3300026121 Bacteria 1162
19 Ga0307517_10055949 3300028786 Bacteria 3860
20 Ga0307517_10296849 3300028786 Bacteria 909
21 Ga0307515_10045877 3300028794 Bacteria 6698
22 Ga0265340_10033133 3300031247 Bacteria 2574
23 Ga0307513_10062274 3300031456 Bacteria 3944
24 Ga0307516_10022005 3300031730 Bacteria 6550
25 Ga0307516_10377945 3300031730 Bacteria 1078
26 Ga0307409_100376523 3300031995 Bacteria 1348
27 Ga0307416_100221016 3300032002 Bacteria 1817
28 Ga0307411_10104102 3300032005 Bacteria 2015
29 Ga0307415_100248819 3300032126 Bacteria 1443
30 Ga0307507_10098464 3300033179 Bacteria 2462
31 Ga0373948_0016186 3300034817 Bacteria 1375
32 Ga0451833_0279753 3300041491 Bacteria 1545
33 Ga0451843_1712162 3300041509 Bacteria 1781
34 Ga0495627_075357 3300046453 Bacteria 982
35 Ga0495603_0008235 3300046455 Bacteria 6300
36 Ga0495603_0045055 3300046455 Bacteria 2631
37 Ga0495629_0001227 3300046459 Bacteria 20125
38 Ga0495629_0019360 3300046459 Bacteria 4864
39 Ga0495605_0002214 3300046474 Bacteria 12141
40 Ga0495664_0081829 3300046477 Bacteria 1936
41 Ga0495664_0174795 3300046477 Bacteria 1303
42 Ga0495585_0051215 3300046492 Bacteria 2288
43 Ga0495585_0073747 3300046492 Bacteria 1857
44 Ga0495585_0137268 3300046492 Bacteria 1283
45 Ga0495594_0000763 3300046499 Bacteria 16543
46 Ga0495594_0016919 3300046499 Bacteria 3847
47 Ga0495594_0048019 3300046499 Bacteria 2345
48 Ga0495607_0044919 3300046501 Bacteria 2601
49 Ga0495583_0055021 3300046506 Bacteria 1799
50 Ga0495606_0003157 3300046507 Bacteria 17830
51 Ga0495610_0030748 3300046512 Bacteria 2809
52 Ga0495616_0010929 3300046513 Bacteria 5228
53 Ga0495620_0004462 3300046515 Bacteria 7884
54 Ga0495628_0036817 3300046516 Bacteria 3925
55 Ga0495628_0080806 3300046516 Bacteria 2526
56 Ga0495631_0010995 3300046518 Bacteria 4468
57 Ga0495643_0042487 3300046522 Bacteria 2476
58 Ga0495644_0106430 3300046523 Bacteria 1063
59 Ga0495648_0038384 3300046524 Bacteria 3064
60 Ga0495648_0059793 3300046524 Bacteria 2271
61 Ga0495666_0036158 3300046526 Bacteria 2405
62 Ga0495640_0017505 3300046533 Bacteria 5340
63 Ga0495640_0061470 3300046533 Bacteria 2551
64 Ga0495640_0160043 3300046533 Bacteria 1443
65 Ga0495622_0012314 3300046557 Bacteria 3956
66 Ga0495633_0033465 3300046558 Bacteria 2478
67 Ga0495667_0165297 3300046559 Bacteria 1423
68 Ga0495668_0069743 3300046616 Bacteria 1933
69 Ga0495668_0097168 3300046616 Bacteria 1611
70 Ga0495634_0053388 3300046642 Bacteria 2707
71 Ga0495611_0020892 3300046648 Bacteria 2822
72 Ga0495625_0057215 3300046660 Bacteria 2774
73 Ga0495661_0074227 3300046665 Bacteria 1980
74 Ga0495588_0008954 3300046674 Bacteria 4608
75 Ga0495588_0047141 3300046674 Bacteria 2212
76 Ga0495657_0006881 3300046675 Bacteria 8835
77 Ga0495657_0049646 3300046675 Bacteria 2825
78 Ga0495613_0005181 3300046689 Bacteria 9788
79 Ga0495613_0005680 3300046689 Bacteria 9346
80 Ga0495613_0014144 3300046689 Bacteria 5920
81 Ga0495624_0004370 3300046690 Bacteria 10357
82 Ga0495624_0018397 3300046690 Bacteria 4673
83 Ga0495671_0021827 3300046692 Bacteria 3358
84 Ga0495589_0034143 3300046794 Bacteria 2554
85 Ga0495589_0041603 3300046794 Bacteria 2292
86 Ga0495600_0029201 3300046809 Bacteria 3570
87 Ga0495600_0104058 3300046809 Bacteria 1850
88 Ga0495660_0089578 3300046810 Bacteria 1601
89 Ga0495604_0271610 3300047317 Bacteria 1148
90 Ga0495636_0018048 3300047318 Bacteria 2830
91 Ga0495676_0000159 3300047321 Bacteria 52170
92 Ga0495676_0001443 3300047321 Bacteria 20515
93 Ga0495676_0066514 3300047321 Bacteria 2792
94 Ga0495683_0027627 3300047323 Bacteria 2901
95 Ga0495687_005538 3300047443 Bacteria 8011
96 Ga0495687_010884 3300047443 Bacteria 4941
97 Ga0495687_022117 3300047443 Bacteria 3059
98 Ga0495687_030517 3300047443 Bacteria 2481
99 Ga0495685_002613 3300047447 Bacteria 5668
100 Ga0495685_032650 3300047447 Bacteria 1789
101 Ga0495685_079405 3300047447 Bacteria 1093
102 Ga0495593_0028174 3300047673 Bacteria 3086
103 Ga0495614_0013794 3300048089 Bacteria 3543
104 Ga0495626_0013847 3300048091 Bacteria 4179
105 Ga0495626_0133075 3300048091 Bacteria 1060
106 Ga0496108_0218664 3300048911 Bacteria 1655
107 Ga0496108_0494501 3300048911 Bacteria 1068
108 Ga0496109_0166709 3300048912 Bacteria 2065
109 Ga0496124_0002072 3300048927 Bacteria 27145
110 Ga0495678_040748 3300049459 Bacteria 1864
111 Ga0501033_0118381 3300049570 Bacteria 1924
112 Ga0501034_0207884 3300049571 Bacteria 1913
113 Ga0501037_0016395 3300049573 Bacteria 5453
114 Ga0501043_0451798 3300049579 Bacteria 965
115 Ga0501047_0195231 3300049581 Bacteria 1886
116 Ga0501048_0111672 3300049582 Bacteria 1930
117 Ga0501035_0457461 3300049822 Bacteria 1055
118 nmdc:mga00v17_31795_c1 3300050491 Bacteria 3114
119 nmdc:mga00v17_65330_c1 3300050491 Bacteria 2244
120 nmdc:mga0yw44_342610_c1 3300050492 Bacteria 1005
121 nmdc:mga0yw44_62485_c1 3300050492 Bacteria 2288
122 nmdc:mga0yw44_70941_c1 3300050492 Bacteria 2161
123 Ga0500644_0007900 3300053088 Bacteria 2787
124 Ga0500573_0006539 3300053140 Bacteria 6319
125 Ga0500604_0016635 3300053151 Bacteria 2028
126 Ga0500616_0000107 3300053153 Bacteria 153426
127 Ga0500616_0000219 3300053153 Bacteria 90032
128 Ga0500616_0014797 3300053153 Bacteria 4474
129 2616702835 2616644814 Bacteria 11555299
130 2644455524 2643221681 Bacteria 3707866
131 2729906511 2728369276 Bacteria 5610032
132 2739363898 2738543034 Bacteria 6084756
133 2772642026 2772190715 Bacteria 6959372
134 2812476917 2811994917 Bacteria 7761064
135 2819695557 2818991463 Bacteria 7948711
136 2844853861 2844852863 Bacteria 3849151
137 2855676112 2855670206 Bacteria 7120389
138 2855682575 2855676851 Bacteria 7063653
139 2857294158 2857288857 Bacteria 7189066
140 2858851686 2858848962 Bacteria 6963058
141 2858882820 2858882152 Bacteria 7230291
142 2858894993 2858888857 Bacteria 7060307
143 2858900002 2858895516 Bacteria 7378898
144 2867375050 2867369537 Bacteria 6501581
145 2869052765 2869048445 Bacteria 6875584
146 2869068729 2869068681 Bacteria 7205615
147 2880490518 2880489317 Bacteria 7096270
148 2880501995 2880495981 Bacteria 7340502
149 2908811952 2908811453 Bacteria 5478616
150 2912760796 2912757875 Bacteria 7940295
151 2929230524 2929226422 Bacteria 7248583
152 2966601890 2966598605 Bacteria 7676064
153 3006425635 3006425503 Bacteria 6491253
154 8023624831 8023623736 Bacteria 8593882
155 8025534367 8025530807 Bacteria 8495698
156 8054708560 8054704163 Bacteria 7247792
157 8054734038 8054727385 Bacteria 7558670
158 8054735581 8054734606 Bacteria 6947278
159 8056040281 8056037122 Bacteria 3854319
160 8056207826 8056207758 Bacteria 8639239
161 Ga0265326_10002267
162 rootL2_10119307
163 Ga0070683_100358355
164 Ga0070668_100008485
165 Ga0068855_100205606
166 Ga0081539_10005841
167 Ga0075365_10013554
168 Ga0075365_10103477
169 Ga0075365_10411227
170 Ga0075364_10043977
171 Ga0075364_10051451
172 Ga0105245_10081574
173 Ga0157375_10298953
174 Ga0183367_1004
175 Ga0207652_10647268
176 Ga0207668_10000579
177 Ga0207678_10595485
178 Ga0207683_10468537
179 Ga0307517_10055949
180 Ga0307517_10296849
181 Ga0307515_10045877
182 Ga0265340_10033133
183 Ga0307513_10062274
184 Ga0307516_10022005
185 Ga0307516_10377945
186 Ga0307409_100376523
187 Ga0307416_100221016
188 Ga0307411_10104102
189 Ga0307415_100248819
190 Ga0307507_10098464
191 Ga0373948_0016186
192 Ga0451833_0279753
193 Ga0451843_1712162
194 Ga0495627_075357
195 Ga0495603_0008235
196 Ga0495603_0045055
197 Ga0495629_0001227
198 Ga0495629_0019360
199 Ga0495605_0002214
200 Ga0495664_0081829
201 Ga0495664_0174795
202 Ga0495585_0051215
203 Ga0495585_0073747
204 Ga0495585_0137268
205 Ga0495594_0000763
206 Ga0495594_0016919
207 Ga0495594_0048019
208 Ga0495607_0044919
209 Ga0495583_0055021
210 Ga0495606_0003157
211 Ga0495610_0030748
212 Ga0495616_0010929
213 Ga0495620_0004462
214 Ga0495628_0036817
215 Ga0495628_0080806
216 Ga0495631_0010995
217 Ga0495643_0042487
218 Ga0495644_0106430
219 Ga0495648_0038384
220 Ga0495648_0059793
221 Ga0495666_0036158
222 Ga0495640_0017505
223 Ga0495640_0061470
224 Ga0495640_0160043
225 Ga0495622_0012314
226 Ga0495633_0033465
227 Ga0495667_0165297
228 Ga0495668_0069743
229 Ga0495668_0097168
230 Ga0495634_0053388
231 Ga0495611_0020892
232 Ga0495625_0057215
233 Ga0495661_0074227
234 Ga0495588_0008954
235 Ga0495588_0047141
236 Ga0495657_0006881
237 Ga0495657_0049646
238 Ga0495613_0005181
239 Ga0495613_0005680
240 Ga0495613_0014144
241 Ga0495624_0004370
242 Ga0495624_0018397
243 Ga0495671_0021827
244 Ga0495589_0034143
245 Ga0495589_0041603
246 Ga0495600_0029201
247 Ga0495600_0104058
248 Ga0495660_0089578
249 Ga0495604_0271610
250 Ga0495636_0018048
251 Ga0495676_0000159
252 Ga0495676_0001443
253 Ga0495676_0066514
254 Ga0495683_0027627
255 Ga0495687_005538
256 Ga0495687_010884
257 Ga0495687_022117
258 Ga0495687_030517
259 Ga0495685_002613
260 Ga0495685_032650
261 Ga0495685_079405
262 Ga0495593_0028174
263 Ga0495614_0013794
264 Ga0495626_0013847
265 Ga0495626_0133075
266 Ga0496108_0218664
267 Ga0496108_0494501
268 Ga0496109_0166709
269 Ga0496124_0002072
270 Ga0495678_040748
271 Ga0501033_0118381
272 Ga0501034_0207884
273 Ga0501037_0016395
274 Ga0501043_0451798
275 Ga0501047_0195231
276 Ga0501048_0111672
277 Ga0501035_0457461
278 nmdc:mga00v17_31795_c1
279 nmdc:mga00v17_65330_c1
280 nmdc:mga0yw44_342610_c1
281 nmdc:mga0yw44_62485_c1
282 nmdc:mga0yw44_70941_c1
283 Ga0500644_0007900
284 Ga0500573_0006539
285 Ga0500604_0016635
286 Ga0500616_0000107
287 Ga0500616_0000219
288 Ga0500616_0014797
289 2616702835
290 2644455524
291 2729906511
292 2739363898
293 2772642026
294 2812476917
295 2819695557
296 2844853861
297 2855676112
298 2855682575
299 2857294158
300 2858851686
301 2858882820
302 2858894993
303 2858900002
304 2867375050
305 2869052765
306 2869068729
307 2880490518
308 2880501995
309 2908811952
310 2912760796
311 2929230524
312 2966601890
313 3006425635
314 8023624831
315 8025534367
316 8054708560
317 8054734038
318 8054735581
319 8056040281
320 8056207826

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

54

292

0.85

PF12146

Hydrolase_4

Serine aminopeptidase, S33

53

292

0.79

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

56

298

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
5h3h-assembly1.cif.gz_A esterase (eaest) from exiguobacterium antarcticum 0.8481 1 272
1a8u-assembly1.cif.gz_B chloroperoxidase t/benzoate complex 0.8432 10 272
4lyd-assembly1.cif.gz_A-2 crystal structure of the s105a mutant of a c-c hydrolase, dxnb2 from sphingomonas wittichii rw1 0.8425 1 272
5h3h-assembly1.cif.gz_A esterase (eaest) from exiguobacterium antarcticum 0.8422 1 272
1brt-assembly1.cif.gz_A bromoperoxidase a2 mutant m99t 0.8405 10 272
ID Description Score Start End Superfamily
af_A0A0R0KMM0_1_93_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8849 1 85 3.40.50.12270
af_Q4CQ94_14_186_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.877 12 129 3.40.50.12270
af_A0A1D6K8I4_16_172_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8499 1 128 3.40.50.1820
5h3hA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8481 1 272 3.40.50.1820
af_A0A0P0WIT7_2_163_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8478 14 127 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A850JSI2-F1-model_v4 Alpha/beta hydrolase 0.9932 54 273 GO:0016787
AF-A0A520IEF1-F1-model_v4 Alpha/beta hydrolase 0.9567 4 119 GO:0016020
GO:0016787
AF-A0A5C8K3P2-F1-model_v4 Alpha/beta hydrolase 0.9511 5 272 GO:0016787
AF-A0A2V7N6K8-F1-model_v4 AB hydrolase-1 domain-containing protein 0.9487 2 119 GO:0003824
AF-A0A7Z0A9N4-F1-model_v4 Pimeloyl-ACP methyl ester carboxylesterase 0.9441 1 106 GO:0003824
GO:0016020

Map