F232894

General Info

Members Datasets Scaffolds Average Seq Length
159 121 318 244

Family's Representative Sequence

Representative Sequence 3300046463|Ga0495653_0168022|Ga0495653_0168022_551_1339
Length 262
Sequence LDQHSQGRTPGSAPASSSNHRAGATAPSLSIVIPAYNESQRLPATLRRIVEWIRAGNRDYTEVIVVDDGSTDGTAEVVQTFQRNFPCVRVLSNPGNRGKGYAVRHGMLEARSDWILYTDADLSTPIEDFQKLHQAAMDQNAEVAIGSRAMDRALVSVHQTLLREYSGRFFNVVMRLTTGLPFHDTQCGFKLYSSAAARQIFARQKLDGFSFDVEDLFIASKLGIKAVEVAVRWSNVEGTKVSLGGGLRSFGELLKIRSMHGG

Samples

Sample ID Description Type Environment
1 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
22 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
23 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
24 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
25 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
26 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
27 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
28 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
29 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
30 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
31 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
32 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
35 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
36 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
37 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
56 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
57 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
58 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
59 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
60 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
61 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
62 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
63 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
64 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
65 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
66 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
67 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
68 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
69 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
70 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
71 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
72 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
73 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
74 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
75 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
76 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
77 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
78 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
79 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
80 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
81 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
82 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
83 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
84 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
85 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
86 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
87 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
88 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
89 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
90 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
91 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
92 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
93 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
94 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
95 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
96 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
108 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
109 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
110 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
111 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
112 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
113 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
114 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
115 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
116 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
117 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
118 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
120 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
121 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.63
Rhizosphere 96.23
Stem 0
Stem Tuber 0
Unclassified 21.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495653_0168022 3300046463 Bacteria 1517
2 Ga0070658_10001435 3300005327 Bacteria 20320
3 Ga0070683_100089148 3300005329 Bacteria 2895
4 Ga0070670_100604991 3300005331 Bacteria 981
5 Ga0070670_100668370 3300005331 Bacteria 933
6 Ga0070680_100004006 3300005336 Bacteria 11021
7 Ga0070680_100145257 3300005336 Bacteria 1990
8 Ga0070660_100190999 3300005339 Unclassified 1659
9 Ga0070671_100150335 3300005355 Bacteria 1966
10 Ga0070673_100173229 3300005364 Bacteria 1843
11 Ga0070667_101064360 3300005367 Unclassified 756
12 Ga0070714_100021450 3300005435 Bacteria 5285
13 Ga0070714_100030735 3300005435 Bacteria 4474
14 Ga0070713_100008790 3300005436 Bacteria 7188
15 Ga0070713_100026112 3300005436 Bacteria 4580
16 Ga0070711_100045479 3300005439 Bacteria 2986
17 Ga0070678_100446878 3300005456 Bacteria 1132
18 Ga0070665_100438287 3300005548 Bacteria 1316
19 Ga0068855_100000182 3300005563 Bacteria 80758
20 Ga0068855_100016260 3300005563 Bacteria 8948
21 Ga0068855_100066375 3300005563 Unclassified 4207
22 Ga0068852_100005280 3300005616 Bacteria 9222
23 Ga0068864_100469250 3300005618 Bacteria 1206
24 Ga0068863_100025918 3300005841 Bacteria 5595
25 Ga0068863_100317178 3300005841 Bacteria 1514
26 Ga0068858_100503662 3300005842 Unclassified 1170
27 Ga0070717_10313409 3300006028 Unclassified 1397
28 Ga0068871_100768662 3300006358 Unclassified 886
29 Ga0105245_10051738 3300009098 Bacteria 3682
30 Ga0105245_10329418 3300009098 Unclassified 1507
31 Ga0105243_10299519 3300009148 Unclassified 1457
32 Ga0105241_10211162 3300009174 Bacteria 1626
33 Ga0105248_10219319 3300009177 Bacteria 2142
34 Ga0105249_10395214 3300009553 Bacteria 1412
35 Ga0105239_10030861 3300010375 Bacteria 5896
36 Ga0105239_10131010 3300010375 Bacteria 2790
37 Ga0157370_10001584 3300013104 Bacteria 28151
38 Ga0157370_10373969 3300013104 Bacteria 1313
39 Ga0157369_10001714 3300013105 Bacteria 26692
40 Ga0157369_10049162 3300013105 Bacteria 4572
41 Ga0157374_10382355 3300013296 Unclassified 1402
42 Ga0157374_10550971 3300013296 Bacteria 1161
43 Ga0157378_10177714 3300013297 Bacteria 2000
44 Ga0163162_10138098 3300013306 Bacteria 2549
45 Ga0163162_10254711 3300013306 Bacteria 1887
46 Ga0157372_10060544 3300013307 Bacteria 4236
47 Ga0157372_10113693 3300013307 Bacteria 3103
48 Ga0157372_10887833 3300013307 Bacteria 1034
49 Ga0157380_10171413 3300014326 Bacteria 1897
50 Ga0157376_10147714 3300014969 Bacteria 2116
51 Ga0213875_10003525 3300021388 Bacteria 8892
52 Ga0207705_10005351 3300025909 Bacteria 9597
53 Ga0207654_10365055 3300025911 Bacteria 997
54 Ga0207663_10313449 3300025916 Bacteria 1176
55 Ga0207660_10358151 3300025917 Bacteria 1170
56 Ga0207687_10054421 3300025927 Bacteria 2799
57 Ga0207700_10007954 3300025928 Bacteria 6528
58 Ga0207700_10083598 3300025928 Bacteria 2499
59 Ga0207664_10022159 3300025929 Bacteria 4739
60 Ga0207664_10023980 3300025929 Bacteria 4580
61 Ga0207644_10275247 3300025931 Bacteria 1350
62 Ga0207644_10712639 3300025931 Unclassified 837
63 Ga0207711_10145552 3300025941 Bacteria 2135
64 Ga0207661_10071297 3300025944 Bacteria 2839
65 Ga0207667_10001528 3300025949 Bacteria 29070
66 Ga0207667_10006389 3300025949 Bacteria 14288
67 Ga0207667_10135016 3300025949 Unclassified 2541
68 Ga0207667_10411881 3300025949 Bacteria 1376
69 Ga0207651_10040883 3300025960 Bacteria 3073
70 Ga0207703_10339219 3300026035 Bacteria 1381
71 Ga0207702_10087795 3300026078 Unclassified 2716
72 Ga0207641_10028315 3300026088 Unclassified 4629
73 Ga0207674_10428430 3300026116 Unclassified 1278
74 Ga0207698_10089799 3300026142 Bacteria 2511
75 Ga0268264_10858475 3300028381 Bacteria 909
76 Ga0265332_10079925 3300031238 Bacteria 1387
77 Ga0265325_10005570 3300031241 Bacteria 7767
78 Ga0265331_10037694 3300031250 Bacteria 2365
79 Ga0265316_10000759 3300031344 Bacteria 35505
80 Ga0265316_10025014 3300031344 Bacteria 4988
81 Ga0265316_10032679 3300031344 Bacteria 4245
82 Ga0265316_10039771 3300031344 Bacteria 3775
83 Ga0265316_10067018 3300031344 Bacteria 2776
84 Ga0265314_10008427 3300031711 Bacteria 8833
85 Ga0373923_0101385 3300035111 Bacteria 1270
86 Ga0373943_0003650 3300035170 Bacteria 6997
87 Ga0373943_0152023 3300035170 Unclassified 1255
88 Ga0373946_0085162 3300035171 Bacteria 1391
89 Ga0373927_0136615 3300035695 Bacteria 1603
90 Ga0373927_0167372 3300035695 Bacteria 1440
91 Ga0373933_0280428 3300035724 Unclassified 1077
92 Ga0373947_0013440 3300035725 Bacteria 4690
93 Ga0373937_0045407 3300036401 Bacteria 4015
94 Ga0373925_0025727 3300037068 Bacteria 4303
95 Ga0373925_0264342 3300037068 Bacteria 1383
96 Ga0395905_0306656 3300037471 Bacteria 1476
97 Ga0436364_0282250 3300037853 Bacteria 8395
98 Ga0436364_1146801 3300037853 Bacteria 4457
99 Ga0436364_1477575 3300037853 Bacteria 1274
100 Ga0436365_1891365 3300039437 Bacteria 3657
101 Ga0436362_0112516 3300039453 Bacteria 1441
102 Ga0451576_0368520 3300045051 Bacteria 1505
103 Ga0466967_1066116 3300045976 Unclassified 805
104 Ga0495629_0232969 3300046459 Bacteria 1269
105 Ga0495651_0078169 3300046462 Bacteria 2503
106 Ga0495651_0207023 3300046462 Unclassified 1368
107 Ga0495653_0210367 3300046463 Unclassified 1314
108 Ga0495580_0022301 3300046472 Bacteria 4661
109 Ga0495582_0067308 3300046473 Bacteria 1979
110 Ga0495594_0090020 3300046499 Bacteria 1719
111 Ga0495608_0151977 3300046511 Unclassified 1475
112 Ga0495618_0087638 3300046514 Bacteria 1991
113 Ga0495630_0052215 3300046517 Bacteria 3060
114 Ga0495652_0180217 3300046529 Unclassified 1622
115 Ga0495652_0190788 3300046529 Bacteria 1564
116 Ga0495587_0085840 3300046536 Bacteria 1822
117 Ga0495645_0019320 3300046543 Bacteria 4906
118 Ga0495667_0029696 3300046559 Bacteria 3679
119 Ga0495667_0047098 3300046559 Bacteria 2849
120 Ga0495635_0105522 3300046663 Bacteria 1925
121 Ga0495635_0256472 3300046663 Unclassified 1178
122 Ga0495623_0034451 3300046679 Bacteria 3247
123 Ga0495623_0050755 3300046679 Bacteria 2627
124 Ga0495613_0170305 3300046689 Unclassified 1546
125 Ga0495600_0072477 3300046809 Bacteria 2250
126 Ga0495581_0112610 3300047315 Bacteria 1582
127 Ga0495604_0140480 3300047317 Unclassified 1726
128 Ga0495674_0142827 3300047319 Bacteria 2011
129 Ga0495674_0227235 3300047319 Bacteria 1541
130 Ga0495684_0011136 3300047471 Bacteria 6952
131 Ga0495684_0164961 3300047471 Unclassified 1650
132 Ga0495602_0022406 3300048088 Bacteria 6183
133 Ga0496112_0646224 3300048915 Unclassified 988
134 Ga0501032_0019819 3300049569 Unclassified 4696
135 Ga0501033_0006556 3300049570 Bacteria 9105
136 Ga0501034_0139198 3300049571 Unclassified 2407
137 Ga0501036_0000334 3300049572 Bacteria 32981
138 Ga0501037_0150972 3300049573 Unclassified 1660
139 Ga0501038_0000320 3300049574 Bacteria 41216
140 Ga0501042_0092115 3300049578 Unclassified 2176
141 Ga0501043_0015536 3300049579 Bacteria 5965
142 Ga0501046_0001044 3300049580 Bacteria 27074
143 Ga0501047_0524848 3300049581 Unclassified 1009
144 Ga0501048_0037707 3300049582 Unclassified 3471
145 Ga0501067_0048208 3300049583 Bacteria 2362
146 Ga0501068_0000723 3300049584 Bacteria 16918
147 Ga0501069_0005954 3300049585 Bacteria 6363
148 Ga0501070_0022721 3300049586 Bacteria 5251
149 Ga0501072_0028326 3300049588 Bacteria 4373
150 Ga0501073_0000736 3300049589 Bacteria 23190
151 Ga0501074_0005619 3300049590 Bacteria 9027
152 Ga0501077_0016597 3300049593 Bacteria 4640
153 Ga0501079_0181257 3300049741 Unclassified 1643
154 Ga0501080_0000006 3300049742 Bacteria 138444
155 Ga0501083_0060268 3300049744 Unclassified 2535
156 Ga0501035_0183881 3300049822 Bacteria 1799
157 Ga0501044_0015040 3300049823 Bacteria 8340
158 Ga0501084_0002006 3300054114 Bacteria 16269
159 Ga0501082_0002854 3300060353 Bacteria 15056
160 Ga0495653_0168022
161 Ga0070658_10001435
162 Ga0070683_100089148
163 Ga0070670_100604991
164 Ga0070670_100668370
165 Ga0070680_100004006
166 Ga0070680_100145257
167 Ga0070660_100190999
168 Ga0070671_100150335
169 Ga0070673_100173229
170 Ga0070667_101064360
171 Ga0070714_100021450
172 Ga0070714_100030735
173 Ga0070713_100008790
174 Ga0070713_100026112
175 Ga0070711_100045479
176 Ga0070678_100446878
177 Ga0070665_100438287
178 Ga0068855_100000182
179 Ga0068855_100016260
180 Ga0068855_100066375
181 Ga0068852_100005280
182 Ga0068864_100469250
183 Ga0068863_100025918
184 Ga0068863_100317178
185 Ga0068858_100503662
186 Ga0070717_10313409
187 Ga0068871_100768662
188 Ga0105245_10051738
189 Ga0105245_10329418
190 Ga0105243_10299519
191 Ga0105241_10211162
192 Ga0105248_10219319
193 Ga0105249_10395214
194 Ga0105239_10030861
195 Ga0105239_10131010
196 Ga0157370_10001584
197 Ga0157370_10373969
198 Ga0157369_10001714
199 Ga0157369_10049162
200 Ga0157374_10382355
201 Ga0157374_10550971
202 Ga0157378_10177714
203 Ga0163162_10138098
204 Ga0163162_10254711
205 Ga0157372_10060544
206 Ga0157372_10113693
207 Ga0157372_10887833
208 Ga0157380_10171413
209 Ga0157376_10147714
210 Ga0213875_10003525
211 Ga0207705_10005351
212 Ga0207654_10365055
213 Ga0207663_10313449
214 Ga0207660_10358151
215 Ga0207687_10054421
216 Ga0207700_10007954
217 Ga0207700_10083598
218 Ga0207664_10022159
219 Ga0207664_10023980
220 Ga0207644_10275247
221 Ga0207644_10712639
222 Ga0207711_10145552
223 Ga0207661_10071297
224 Ga0207667_10001528
225 Ga0207667_10006389
226 Ga0207667_10135016
227 Ga0207667_10411881
228 Ga0207651_10040883
229 Ga0207703_10339219
230 Ga0207702_10087795
231 Ga0207641_10028315
232 Ga0207674_10428430
233 Ga0207698_10089799
234 Ga0268264_10858475
235 Ga0265332_10079925
236 Ga0265325_10005570
237 Ga0265331_10037694
238 Ga0265316_10000759
239 Ga0265316_10025014
240 Ga0265316_10032679
241 Ga0265316_10039771
242 Ga0265316_10067018
243 Ga0265314_10008427
244 Ga0373923_0101385
245 Ga0373943_0003650
246 Ga0373943_0152023
247 Ga0373946_0085162
248 Ga0373927_0136615
249 Ga0373927_0167372
250 Ga0373933_0280428
251 Ga0373947_0013440
252 Ga0373937_0045407
253 Ga0373925_0025727
254 Ga0373925_0264342
255 Ga0395905_0306656
256 Ga0436364_0282250
257 Ga0436364_1146801
258 Ga0436364_1477575
259 Ga0436365_1891365
260 Ga0436362_0112516
261 Ga0451576_0368520
262 Ga0466967_1066116
263 Ga0495629_0232969
264 Ga0495651_0078169
265 Ga0495651_0207023
266 Ga0495653_0210367
267 Ga0495580_0022301
268 Ga0495582_0067308
269 Ga0495594_0090020
270 Ga0495608_0151977
271 Ga0495618_0087638
272 Ga0495630_0052215
273 Ga0495652_0180217
274 Ga0495652_0190788
275 Ga0495587_0085840
276 Ga0495645_0019320
277 Ga0495667_0029696
278 Ga0495667_0047098
279 Ga0495635_0105522
280 Ga0495635_0256472
281 Ga0495623_0034451
282 Ga0495623_0050755
283 Ga0495613_0170305
284 Ga0495600_0072477
285 Ga0495581_0112610
286 Ga0495604_0140480
287 Ga0495674_0142827
288 Ga0495674_0227235
289 Ga0495684_0011136
290 Ga0495684_0164961
291 Ga0495602_0022406
292 Ga0496112_0646224
293 Ga0501032_0019819
294 Ga0501033_0006556
295 Ga0501034_0139198
296 Ga0501036_0000334
297 Ga0501037_0150972
298 Ga0501038_0000320
299 Ga0501042_0092115
300 Ga0501043_0015536
301 Ga0501046_0001044
302 Ga0501047_0524848
303 Ga0501048_0037707
304 Ga0501067_0048208
305 Ga0501068_0000723
306 Ga0501069_0005954
307 Ga0501070_0022721
308 Ga0501072_0028326
309 Ga0501073_0000736
310 Ga0501074_0005619
311 Ga0501077_0016597
312 Ga0501079_0181257
313 Ga0501080_0000006
314 Ga0501083_0060268
315 Ga0501035_0183881
316 Ga0501044_0015040
317 Ga0501084_0002006
318 Ga0501082_0002854

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

30

201

0.94

PF10111

Glyco_tranf_2_2

Glycosyltransferase like family 2

30

204

0.83

PF13641

Glyco_tranf_2_3

Glycosyltransferase like family 2

27

233

0.74

PF13704

Glyco_tranf_2_4

Glycosyl transferase family 2

36

132

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mm0-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp-mannose and mn2+ (donor complex) 0.8348 26 254
5eke-assembly1.cif.gz_A structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (f215a mutant) 0.8211 20 229
5mm1-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp and dolichyl phosphate mannose 0.8184 28 255
5ekp-assembly1.cif.gz_A structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (wt) 0.807 20 255
7msn-assembly1.cif.gz_B suns glycosin s-glycosyltransferase 0.7784 24 119
ID Description Score Start End Superfamily
af_P40350_49_327_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9129 23 256 3.90.550.10
af_Q9VLQ1_42_326_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8976 23 254 3.90.550.10
af_P77293_1_188_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8773 28 215 3.90.550.10
af_O60061_43_318_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8649 16 254 3.90.550.10
af_K7MVE2_46_307_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8623 18 238 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A1V5P7M5-F1-model_v4 Undecaprenyl-phosphate mannosyltransferase (EC 2.4.1.54) 0.9793 79 255 GO:0006487
GO:0047267
AF-A0A0E2GBG8-F1-model_v4 deleted 0.9672 22 144
AF-A0A1F9X9S2-F1-model_v4 dolichyl-phosphate beta-glucosyltransferase (EC 2.4.1.117) 0.9639 24 255 GO:0006487
GO:0016757
AF-A0A4V1ZS11-F1-model_v4 Glycosyltransferase family 2 protein 0.9638 25 127 GO:0005886
GO:0099621
AF-A0A7X9IKT4-F1-model_v4 dolichyl-phosphate beta-glucosyltransferase (EC 2.4.1.117) 0.9604 22 254 GO:0006487
GO:0016757

Map