F231371

General Info

Members Datasets Scaffolds Average Seq Length
159 87 318 237

Family's Representative Sequence

Representative Sequence 3300005344|Ga0070661_100100733|Ga0070661_1001007332
Length 256
Sequence LGAGILFVAFSKNKNAFYKQVCLVTGAGSGIGRATAERFASEGGKVVVIDRDEQGGNETVDGIKKNNGEAIFSKCDVGIETDIKASVQLALDTWQQIDVVVNNAAMMTFKKIIDLSSEEWDKVMQVNLRSVFLFCKYTIPHLNNGAIVNVSSVHAHETTANVVPYASSKGAMEAFIRGVSLEYPYPKLRINCVAPGAVDTPMLWNNPNVKSGAEKIEGAIGKPEELAAAICFMASDDASYINGTTLVVDGGRLDIL

Samples

Sample ID Description Type Environment
1 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
31 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
32 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
35 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
40 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
41 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
45 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
46 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
47 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
72 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
73 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
74 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
75 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
76 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
77 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
78 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
79 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
80 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
81 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
82 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
83 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
84 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
85 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
86 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
87 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.23
Metatranscriptomes 3.77
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.89
Rhizosphere 90.57
Stem 0
Stem Tuber 0
Unclassified 13.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070661_100100733 3300005344 Bacteria 2148
2 Ga0058863_10787561 3300004799 Bacteria 1306
3 Ga0058862_10719500 3300004803 Bacteria 3265
4 Ga0065714_10064426 3300005288 Bacteria 186606
5 Ga0065712_10021286 3300005290 Bacteria 1388
6 Ga0065712_10067732 3300005290 Bacteria 130748
7 Ga0065715_10001551 3300005293 Bacteria 7061
8 Ga0070658_10000654 3300005327 Bacteria 29929
9 Ga0070658_10067216 3300005327 Bacteria 2929
10 Ga0070658_10206475 3300005327 Bacteria 1659
11 Ga0070658_10228845 3300005327 Unclassified 1574
12 Ga0070658_10522245 3300005327 Bacteria 1026
13 Ga0070683_100022405 3300005329 Bacteria 5645
14 Ga0070683_100100352 3300005329 Bacteria 2725
15 Ga0070683_100467604 3300005329 Bacteria 1204
16 Ga0070683_100469004 3300005329 Bacteria 1202
17 Ga0070666_10453801 3300005335 Bacteria 926
18 Ga0070680_100000346 3300005336 Bacteria 31165
19 Ga0070680_100109722 3300005336 Bacteria 2296
20 Ga0070680_100163356 3300005336 Bacteria 1872
21 Ga0070682_100448281 3300005337 Bacteria 988
22 Ga0070660_100009168 3300005339 Bacteria 6949
23 Ga0070661_100034335 3300005344 Bacteria 3678
24 Ga0070661_100211743 3300005344 Bacteria 1484
25 Ga0070671_100140718 3300005355 Unclassified 2036
26 Ga0070671_100246505 3300005355 Unclassified 1517
27 Ga0070659_100173856 3300005366 Bacteria 1766
28 Ga0070714_100005926 3300005435 Bacteria 9381
29 Ga0070714_100059624 3300005435 Bacteria 3273
30 Ga0070714_100243116 3300005435 Bacteria 1662
31 Ga0070681_10003104 3300005458 Bacteria 15433
32 Ga0070681_10073029 3300005458 Bacteria 3393
33 Ga0070681_10272291 3300005458 Bacteria 1605
34 Ga0070679_100494433 3300005530 Bacteria 1167
35 Ga0070684_100086505 3300005535 Bacteria 2782
36 Ga0068855_100000909 3300005563 Bacteria 36729
37 Ga0068855_100006329 3300005563 Bacteria 14431
38 Ga0068855_100217819 3300005563 Bacteria 2142
39 Ga0070664_100000131 3300005564 Bacteria 49975
40 Ga0070664_100006204 3300005564 Bacteria 9659
41 Ga0070664_100059415 3300005564 Bacteria 3252
42 Ga0070664_100726784 3300005564 Unclassified 926
43 Ga0068854_100388396 3300005578 Bacteria 1152
44 Ga0068854_100442101 3300005578 Bacteria 1084
45 Ga0068852_100000882 3300005616 Bacteria 19855
46 Ga0068852_100162903 3300005616 Bacteria 2084
47 Ga0068852_100502127 3300005616 Bacteria 1208
48 Ga0068852_100590929 3300005616 Bacteria 1114
49 Ga0068864_100175881 3300005618 Bacteria 1954
50 Ga0097621_100078203 3300006237 Bacteria 2748
51 Ga0068871_100048523 3300006358 Bacteria 3428
52 Ga0068871_100063489 3300006358 Bacteria 3021
53 Ga0075436_100281040 3300006914 Bacteria 1190
54 Ga0105240_10001690 3300009093 Bacteria 37354
55 Ga0105240_10636629 3300009093 Unclassified 1170
56 Ga0105237_10803716 3300009545 Unclassified 947
57 Ga0105239_10181001 3300010375 Unclassified 2358
58 Ga0157373_10044970 3300013100 Bacteria 3152
59 Ga0157371_10043674 3300013102 Bacteria 3192
60 Ga0157370_10000270 3300013104 Bacteria 65780
61 Ga0157370_10429140 3300013104 Bacteria 1215
62 Ga0157369_10000955 3300013105 Bacteria 36678
63 Ga0157369_10156920 3300013105 Bacteria 2403
64 Ga0157369_10240168 3300013105 Bacteria 1892
65 Ga0157374_10265045 3300013296 Bacteria 1693
66 Ga0157374_10279111 3300013296 Bacteria 1649
67 Ga0157378_10014540 3300013297 Bacteria 6891
68 Ga0163162_10005106 3300013306 Bacteria 12653
69 Ga0157372_10011023 3300013307 Bacteria 9622
70 Ga0157372_10314820 3300013307 Bacteria 1822
71 Ga0157372_10375857 3300013307 Bacteria 1656
72 Ga0157372_10383006 3300013307 Bacteria 1639
73 Ga0157372_10407905 3300013307 Unclassified 1583
74 Ga0157372_10609003 3300013307 Unclassified 1273
75 Ga0157372_10613341 3300013307 Bacteria 1268
76 Ga0157372_10704494 3300013307 Unclassified 1175
77 Ga0157375_10006886 3300013308 Bacteria 9915
78 Ga0157377_10040772 3300014745 Bacteria 2572
79 Ga0157376_10037525 3300014969 Bacteria 3935
80 Ga0157376_10266737 3300014969 Unclassified 1606
81 Ga0157376_10312339 3300014969 Bacteria 1491
82 Ga0206351_10304619 3300020077 Bacteria 2223
83 Ga0206352_10771248 3300020078 Unclassified 955
84 Ga0206350_10653439 3300020080 Unclassified 873
85 Ga0213873_10076170 3300021358 Bacteria 932
86 Ga0213876_10015687 3300021384 Plasmid 4010
87 Ga0213876_10126930 3300021384 Bacteria 1355
88 Ga0213875_10000383 3300021388 Bacteria 39968
89 Ga0224712_10139162 3300022467 Unclassified 1067
90 Ga0207647_10000094 3300025904 Bacteria 68043
91 Ga0207705_10003359 3300025909 Bacteria 12159
92 Ga0207705_10077920 3300025909 Bacteria 2411
93 Ga0207707_10005110 3300025912 Bacteria 11503
94 Ga0207695_10002695 3300025913 Bacteria 25899
95 Ga0207695_10283499 3300025913 Bacteria 1550
96 Ga0207671_10015807 3300025914 Bacteria 5890
97 Ga0207660_10001137 3300025917 Bacteria 17792
98 Ga0207660_10079008 3300025917 Bacteria 2412
99 Ga0207657_10086937 3300025919 Bacteria 2616
100 Ga0207649_10132199 3300025920 Bacteria 1697
101 Ga0207649_10422840 3300025920 Bacteria 1001
102 Ga0207652_10079380 3300025921 Bacteria 2867
103 Ga0207664_10010050 3300025929 Bacteria 6668
104 Ga0207664_10019736 3300025929 Bacteria 4988
105 Ga0207664_10033840 3300025929 Bacteria 3932
106 Ga0207644_10016430 3300025931 Bacteria 4979
107 Ga0207690_10388989 3300025932 Bacteria 1110
108 Ga0207691_10612333 3300025940 Unclassified 921
109 Ga0207711_10485216 3300025941 Unclassified 1151
110 Ga0207689_10210101 3300025942 Bacteria 1608
111 Ga0207661_10081236 3300025944 Bacteria 2677
112 Ga0207661_10098538 3300025944 Bacteria 2450
113 Ga0207661_10179718 3300025944 Bacteria 1847
114 Ga0207661_10358578 3300025944 Bacteria 1317
115 Ga0207679_10004811 3300025945 Bacteria 8414
116 Ga0207679_10029444 3300025945 Bacteria 3823
117 Ga0207679_10041829 3300025945 Bacteria 3289
118 Ga0207667_10000307 3300025949 Bacteria 67918
119 Ga0207667_10009907 3300025949 Bacteria 11179
120 Ga0207667_10904438 3300025949 Bacteria 874
121 Ga0207651_10031838 3300025960 Bacteria 3378
122 Ga0207640_10169582 3300025981 Bacteria 1625
123 Ga0207641_10433316 3300026088 Bacteria 1268
124 Ga0207676_10399436 3300026095 Bacteria 1284
125 Ga0207698_10030901 3300026142 Bacteria 3859
126 Ga0207698_10365335 3300026142 Bacteria 1368
127 Ga0207698_10455988 3300026142 Bacteria 1235
128 Ga0207698_10479473 3300026142 Unclassified 1206
129 Ga0207698_10611278 3300026142 Bacteria 1076
130 Ga0373927_0210295 3300035695 Bacteria 1278
131 Ga0373937_0257026 3300036401 Bacteria 1647
132 Ga0436364_0201680 3300037853 Bacteria 3179
133 Ga0436364_0593069 3300037853 Bacteria 62407
134 Ga0436364_0631757 3300037853 Bacteria 1569
135 Ga0436364_0989912 3300037853 Unclassified 1056
136 Ga0395901_0293698 3300038443 Bacteria 1686
137 Ga0436365_0533642 3300039437 Bacteria 11974
138 Ga0436365_0629765 3300039437 Bacteria 4468
139 Ga0436365_1205082 3300039437 Bacteria 5864
140 Ga0436365_1838531 3300039437 Bacteria 2779
141 Ga0436363_1452617 3300039450 Bacteria 3385
142 Ga0436362_0716165 3300039453 Bacteria 847
143 Ga0436362_0870659 3300039453 Bacteria 932
144 Ga0439458_0003065 3300042157 Bacteria 3983
145 Ga0466966_0052099 3300044684 Bacteria 2601
146 Ga0466966_0190542 3300044684 Unclassified 1242
147 Ga0466966_0294772 3300044684 Bacteria 975
148 Ga0466963_0028109 3300044694 Bacteria 3607
149 Ga0466963_0215645 3300044694 Unclassified 1343
150 Ga0466957_0020097 3300044842 Bacteria 3930
151 Ga0466959_0214157 3300045049 Unclassified 1338
152 Ga0466958_0015623 3300045836 Bacteria 4354
153 Ga0466958_0029251 3300045836 Bacteria 3269
154 Ga0466967_0450326 3300045976 Unclassified 1258
155 Ga0466967_0606931 3300045976 Bacteria 1080
156 Ga0496107_0200040 3300048910 Bacteria 1485
157 Ga0496107_0398674 3300048910 Viruses 1023
158 Ga0496112_0236291 3300048915 Bacteria 1781
159 nmdc:mga08x19_237249_c1 3300050514 Bacteria 1256
160 Ga0070661_100100733
161 Ga0058863_10787561
162 Ga0058862_10719500
163 Ga0065714_10064426
164 Ga0065712_10021286
165 Ga0065712_10067732
166 Ga0065715_10001551
167 Ga0070658_10000654
168 Ga0070658_10067216
169 Ga0070658_10206475
170 Ga0070658_10228845
171 Ga0070658_10522245
172 Ga0070683_100022405
173 Ga0070683_100100352
174 Ga0070683_100467604
175 Ga0070683_100469004
176 Ga0070666_10453801
177 Ga0070680_100000346
178 Ga0070680_100109722
179 Ga0070680_100163356
180 Ga0070682_100448281
181 Ga0070660_100009168
182 Ga0070661_100034335
183 Ga0070661_100211743
184 Ga0070671_100140718
185 Ga0070671_100246505
186 Ga0070659_100173856
187 Ga0070714_100005926
188 Ga0070714_100059624
189 Ga0070714_100243116
190 Ga0070681_10003104
191 Ga0070681_10073029
192 Ga0070681_10272291
193 Ga0070679_100494433
194 Ga0070684_100086505
195 Ga0068855_100000909
196 Ga0068855_100006329
197 Ga0068855_100217819
198 Ga0070664_100000131
199 Ga0070664_100006204
200 Ga0070664_100059415
201 Ga0070664_100726784
202 Ga0068854_100388396
203 Ga0068854_100442101
204 Ga0068852_100000882
205 Ga0068852_100162903
206 Ga0068852_100502127
207 Ga0068852_100590929
208 Ga0068864_100175881
209 Ga0097621_100078203
210 Ga0068871_100048523
211 Ga0068871_100063489
212 Ga0075436_100281040
213 Ga0105240_10001690
214 Ga0105240_10636629
215 Ga0105237_10803716
216 Ga0105239_10181001
217 Ga0157373_10044970
218 Ga0157371_10043674
219 Ga0157370_10000270
220 Ga0157370_10429140
221 Ga0157369_10000955
222 Ga0157369_10156920
223 Ga0157369_10240168
224 Ga0157374_10265045
225 Ga0157374_10279111
226 Ga0157378_10014540
227 Ga0163162_10005106
228 Ga0157372_10011023
229 Ga0157372_10314820
230 Ga0157372_10375857
231 Ga0157372_10383006
232 Ga0157372_10407905
233 Ga0157372_10609003
234 Ga0157372_10613341
235 Ga0157372_10704494
236 Ga0157375_10006886
237 Ga0157377_10040772
238 Ga0157376_10037525
239 Ga0157376_10266737
240 Ga0157376_10312339
241 Ga0206351_10304619
242 Ga0206352_10771248
243 Ga0206350_10653439
244 Ga0213873_10076170
245 Ga0213876_10015687
246 Ga0213876_10126930
247 Ga0213875_10000383
248 Ga0224712_10139162
249 Ga0207647_10000094
250 Ga0207705_10003359
251 Ga0207705_10077920
252 Ga0207707_10005110
253 Ga0207695_10002695
254 Ga0207695_10283499
255 Ga0207671_10015807
256 Ga0207660_10001137
257 Ga0207660_10079008
258 Ga0207657_10086937
259 Ga0207649_10132199
260 Ga0207649_10422840
261 Ga0207652_10079380
262 Ga0207664_10010050
263 Ga0207664_10019736
264 Ga0207664_10033840
265 Ga0207644_10016430
266 Ga0207690_10388989
267 Ga0207691_10612333
268 Ga0207711_10485216
269 Ga0207689_10210101
270 Ga0207661_10081236
271 Ga0207661_10098538
272 Ga0207661_10179718
273 Ga0207661_10358578
274 Ga0207679_10004811
275 Ga0207679_10029444
276 Ga0207679_10041829
277 Ga0207667_10000307
278 Ga0207667_10009907
279 Ga0207667_10904438
280 Ga0207651_10031838
281 Ga0207640_10169582
282 Ga0207641_10433316
283 Ga0207676_10399436
284 Ga0207698_10030901
285 Ga0207698_10365335
286 Ga0207698_10455988
287 Ga0207698_10479473
288 Ga0207698_10611278
289 Ga0373927_0210295
290 Ga0373937_0257026
291 Ga0436364_0201680
292 Ga0436364_0593069
293 Ga0436364_0631757
294 Ga0436364_0989912
295 Ga0395901_0293698
296 Ga0436365_0533642
297 Ga0436365_0629765
298 Ga0436365_1205082
299 Ga0436365_1838531
300 Ga0436363_1452617
301 Ga0436362_0716165
302 Ga0436362_0870659
303 Ga0439458_0003065
304 Ga0466966_0052099
305 Ga0466966_0190542
306 Ga0466966_0294772
307 Ga0466963_0028109
308 Ga0466963_0215645
309 Ga0466957_0020097
310 Ga0466959_0214157
311 Ga0466958_0015623
312 Ga0466958_0029251
313 Ga0466967_0450326
314 Ga0466967_0606931
315 Ga0496107_0200040
316 Ga0496107_0398674
317 Ga0496112_0236291
318 nmdc:mga08x19_237249_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

20

210

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

26

252

0.95

PF08659

KR

KR domain

20

181

0.92

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

22

193

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
5u8p-assembly1.cif.gz_A crystal structure of a short chain dehydrogenase from burkholderia cenocepacia j2315 in complex with nad 0.9079 18 225
7v0h-assembly1.cif.gz_B crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with nadp and a potential reaction product 0.9005 1 225
3r3s-assembly1.cif.gz_D structure of the ygha oxidoreductase from salmonella enterica 0.8971 2 225
2uvd-assembly1.cif.gz_C the crystal structure of a 3-oxoacyl-(acyl carrier protein) reductase from bacillus anthracis (ba3989) 0.8961 3 225
4dmm-assembly1.cif.gz_A 3-oxoacyl-[acyl-carrier-protein] reductase from synechococcus elongatus pcc 7942 in complex with nadp 0.8937 1 225
ID Description Score Start End Superfamily
af_K7KGR3_30_220_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9042 53 225 3.40.50.720
af_P0AET8_1_255_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8922 2 225 3.40.50.720
af_Q9WV68_2_278_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8909 3 225 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8895 3 168 3.40.50.720
af_B7FAC8_69_312_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8858 6 225 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A848HXJ2-F1-model_v4 SDR family oxidoreductase 0.9305 1 229 GO:0006633
GO:0016616
GO:0048038
AF-A0A4Q6BJC9-F1-model_v4 SDR family oxidoreductase 0.9261 3 178 GO:0016491
AF-A0A847XL90-F1-model_v4 SDR family oxidoreductase 0.9252 6 170 GO:0006633
GO:0016616
GO:0048038
AF-A0A3N5HV91-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9229 2 177
AF-A0A848HXJ2-F1-model_v4 SDR family oxidoreductase 0.9228 1 229 GO:0006633
GO:0016616
GO:0048038

Map