F230984

General Info

Members Datasets Scaffolds Average Seq Length
159 119 150 763

Family's Representative Sequence

Representative Sequence 3300001979|JGI24740J21852_10003830|JGI24740J21852_100038303
Length 824
Sequence MKTGSLVICGRSFTIRPDPLPAFKKFLYIQPPISYLNLMNNKILIAAACMAVTTAVEAQTNQSLTVQDYARAESMLSYNTEALIDRSTIVPNWLPNGKFWYRVLTAQGSEFILVDPVKGTRAPAFNQEKLAAAITKATGKPCSAYMLPLMSFNFSADGKAIVFSSGGKQWKCDLQQYNCEADNNTPVINNXNALPYNRRNPAPGNEVVSPDGKKAAFIKEHNLWVRDLASNQQTQLTTDGVQDLGYATDNAGWSSSDKPVLRWSHDSKKIATFRQDERHVNSMYLVTTNVGAPTLQAWKYPLPGDSTIITIQRVIIDVEDPKVINIQVGPDAHRGTLSDDISSSGTFDDVDWSDDNTQLAFVSTSRDHKEEKLRIADAATGAVREVLEEKVPTQYESGQGAINWCYLKSSNEIIWYSERDNWGHLYLYDAATGKLKNQVTKGDWVVTKLVKVDEKKRELYFIADGREPGNPYFSHFYKIGFDGQHLTLLTPEEGNHQVSLSPDNSYFIDSYSQPNIPPVTVLRKMDGKLVTNLEKADVSRLTAAGWHAAKPFSVKAHDGKTDIYGLLYTPSNLDPQKKYPIIDYIYPGPQGGSVGGNWSFVASRIDHQALAELGFVVMVLEGTSNPLRSKSFHDMSYGNMAENTLPDQVGGIRQLAAQYSYIDTSRIGIWGHSGGGFATACAMFRYPDFFKVGISESGNHDNRNYEDDWGERYNGLAANSDYEAQANQKYAANLKGKLLLAHGMMDNNVPPYNTLLVVEALEKANKDYDLIIFPNSKHGYGAYTYYMMRRRWDYFVRNLLHAEPPKEYDLKMKMDPRNSFGTRN

Samples

Sample ID Description Type Environment
1 2739367656 Pedobacter sp. CF523 Isolate Unclassified
2 2739367663 Pedobacter sp. YR510 Isolate Unclassified
3 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
4 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
5 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
6 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
7 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
8 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
9 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
10 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
11 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
12 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
60 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
61 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
64 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
66 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
92 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
93 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
94 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
95 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
101 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
102 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
103 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
104 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
105 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
106 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
107 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
108 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
109 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
110 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
111 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
115 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
116 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
117 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
118 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
119 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.71
Metatranscriptomes 0.63
Isolates 5.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.58
Nodule 0
Rhizoplane 0
Rhizosphere 73.58
Stem 0
Stem Tuber 0
Unclassified 13.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10003830 3300001979 Bacteria 6538
2 JGI24737J22298_10003388 3300001990 Bacteria 5637
3 JGI24751J29686_10001500 3300002459 Bacteria 4852
4 JGI25154J39366_1000227 3300002738 Bacteria 37673
5 JGI25153J46596_10003831 3300003215 Bacteria 8291
6 rootH1_10014780 3300003316 Bacteria 5967
7 rootH2_10001891 3300003320 Bacteria 464318
8 rootL2_10138024 3300003322 Bacteria 5643
9 rootH1_10014018 3300003323 Bacteria 16925
10 JGI25160J50197_1000702 3300003354 Bacteria 18444
11 Ga0055526_1006464 3300003771 Bacteria 6355
12 Ga0055528_1002201 3300003790 Bacteria 10644
13 Ga0055530_10000570 3300003791 Bacteria 31968
14 Ga0055531_10000068 3300003794 Bacteria 112187
15 Ga0058862_12687063 3300004803 Bacteria 2489
16 Ga0065165_1000012 3300005262 Bacteria 303241
17 Ga0070658_10000091 3300005327 Bacteria 81263
18 Ga0070658_10029768 3300005327 Bacteria 4388
19 Ga0070676_10009631 3300005328 Bacteria 5222
20 Ga0070680_100005010 3300005336 Bacteria 9987
21 Ga0070682_100030611 3300005337 Bacteria 3250
22 Ga0070673_100000400 3300005364 Bacteria 22985
23 Ga0070659_100001750 3300005366 Bacteria 15590
24 Ga0070678_100007009 3300005456 Bacteria 6659
25 Ga0070662_100000045 3300005457 Bacteria 67900
26 Ga0068867_100004573 3300005459 Bacteria 9730
27 Ga0070685_10003391 3300005466 Bacteria 8104
28 Ga0070685_10022223 3300005466 Bacteria 3455
29 Ga0070698_100000219 3300005471 Bacteria 56179
30 Ga0070698_100005876 3300005471 Bacteria 13403
31 Ga0070698_100031124 3300005471 Bacteria 5532
32 Ga0070684_100092798 3300005535 Bacteria 2687
33 Ga0070665_100000020 3300005548 Bacteria 389687
34 Ga0068857_100053888 3300005577 Bacteria 3568
35 Ga0068856_100000899 3300005614 Bacteria 31842
36 Ga0068852_100001345 3300005616 Bacteria 16491
37 Ga0068863_100014348 3300005841 Bacteria 7630
38 Ga0097621_100004382 3300006237 Bacteria 9821
39 Ga0068871_100000100 3300006358 Bacteria 51253
40 Ga0068865_100000174 3300006881 Bacteria 35630
41 Ga0105240_10000063 3300009093 Bacteria 215936
42 Ga0105240_10000071 3300009093 Bacteria 204197
43 Ga0105240_10001351 3300009093 Bacteria 42091
44 Ga0105240_10003631 3300009093 Bacteria 23897
45 Ga0105240_10070913 3300009093 Bacteria 4309
46 Ga0105241_10000086 3300009174 Bacteria 69935
47 Ga0105241_10011345 3300009174 Bacteria 6532
48 Ga0105242_10002305 3300009176 Bacteria 15055
49 Ga0105237_10000922 3300009545 Bacteria 39546
50 Ga0105237_10001169 3300009545 Bacteria 35074
51 Ga0105237_10006236 3300009545 Bacteria 13279
52 Ga0105238_10017856 3300009551 Bacteria 7213
53 Ga0105238_10045431 3300009551 Bacteria 4437
54 Ga0105239_10000040 3300010375 Bacteria 201445
55 Ga0105239_10015133 3300010375 Bacteria 8551
56 Ga0105239_10030941 3300010375 Bacteria 5888
57 Ga0105239_10114490 3300010375 Bacteria 2991
58 Ga0157373_10000083 3300013100 Bacteria 81952
59 Ga0157371_10012966 3300013102 Bacteria 6348
60 Ga0157370_10001059 3300013104 Bacteria 34597
61 Ga0157374_10000128 3300013296 Bacteria 69753
62 Ga0157374_10000202 3300013296 Bacteria 54739
63 Ga0163162_10000032 3300013306 Bacteria 156609
64 Ga0163162_10020083 3300013306 Bacteria 6560
65 Ga0157372_10006836 3300013307 Bacteria 12131
66 Ga0157372_10017186 3300013307 Bacteria 7765
67 Ga0157375_10003434 3300013308 Bacteria 13738
68 Ga0157375_10005988 3300013308 Bacteria 10607
69 Ga0163161_10000179 3300017792 Bacteria 57833
70 Ga0163161_10000258 3300017792 Bacteria 46621
71 Ga0163161_10017514 3300017792 Bacteria 5013
72 Ga0209646_1000009 3300025246 Bacteria 652154
73 Ga0209026_1000188 3300025250 Bacteria 90347
74 Ga0209026_1000348 3300025250 Bacteria 44090
75 Ga0209673_1000016 3300025273 Bacteria 506202
76 Ga0209673_1000111 3300025273 Bacteria 180094
77 Ga0209564_1001725 3300025295 Bacteria 20505
78 Ga0209564_1001936 3300025295 Bacteria 18486
79 Ga0209758_1002575 3300025297 Bacteria 18208
80 Ga0209758_1010704 3300025297 Bacteria 5444
81 Ga0209758_1010772 3300025297 Bacteria 5414
82 Ga0209050_1000444 3300025298 Bacteria 74945
83 Ga0207426_1000606 3300025302 Bacteria 46465
84 Ga0209257_1000001 3300025304 Bacteria 2274655
85 Ga0209257_1004163 3300025304 Bacteria 11486
86 Ga0207647_10000511 3300025904 Bacteria 30935
87 Ga0207645_10000874 3300025907 Bacteria 25051
88 Ga0207643_10018542 3300025908 Bacteria 3811
89 Ga0207705_10000132 3300025909 Bacteria 81270
90 Ga0207654_10003772 3300025911 Bacteria 7635
91 Ga0207654_10010382 3300025911 Bacteria 4741
92 Ga0207707_10043782 3300025912 Bacteria 3903
93 Ga0207695_10000068 3300025913 Bacteria 324859
94 Ga0207695_10000133 3300025913 Bacteria 222573
95 Ga0207695_10001232 3300025913 Bacteria 43800
96 Ga0207695_10015222 3300025913 Bacteria 9070
97 Ga0207671_10002015 3300025914 Bacteria 22339
98 Ga0207671_10005309 3300025914 Bacteria 11938
99 Ga0207671_10005416 3300025914 Bacteria 11755
100 Ga0207671_10006852 3300025914 Bacteria 10054
101 Ga0207660_10052143 3300025917 Bacteria 2911
102 Ga0207652_10059536 3300025921 Bacteria 3292
103 Ga0207644_10009285 3300025931 Bacteria 6454
104 Ga0207690_10001899 3300025932 Bacteria 12826
105 Ga0207706_10000120 3300025933 Bacteria 84222
106 Ga0207686_10002640 3300025934 Bacteria 9726
107 Ga0207686_10007373 3300025934 Bacteria 5921
108 Ga0207704_10000099 3300025938 Bacteria 48088
109 Ga0207651_10014877 3300025960 Bacteria 4505
110 Ga0207712_10002212 3300025961 Bacteria 12670
111 Ga0207677_10047002 3300026023 Bacteria 2895
112 Ga0207639_10007594 3300026041 Bacteria 7398
113 Ga0207702_10000507 3300026078 Bacteria 43964
114 Ga0207641_10000371 3300026088 Bacteria 53368
115 Ga0207641_10009558 3300026088 Bacteria 7987
116 Ga0207648_10023973 3300026089 Bacteria 5454
117 Ga0207698_10022785 3300026142 Bacteria 4362
118 Ga0268266_10000018 3300028379 Bacteria 569141
119 Ga0307517_10002277 3300028786 Bacteria 30968
120 Ga0307517_10004683 3300028786 Bacteria 20955
121 Ga0265327_10001009 3300031251 Bacteria 39899
122 Ga0307516_10003984 3300031730 Bacteria 18549
123 Ga0307510_10000492 3300033180 Bacteria 39015
124 Ga0307510_10002326 3300033180 Bacteria 21483
125 Ga0395899_0000629 3300037312 Bacteria 36706
126 Ga0395900_0000480 3300037418 Bacteria 56578
127 Ga0395898_0006652 3300037466 Bacteria 12328
128 Ga0395905_0000612 3300037471 Bacteria 47853
129 Ga0395905_0000738 3300037471 Bacteria 43061
130 Ga0395901_0000853 3300038443 Bacteria 33521
131 Ga0466972_0000021 3300044658 Bacteria 196266
132 Ga0466970_0000749 3300044765 Bacteria 15751
133 Ga0495606_0022788 3300046507 Bacteria 4551
134 Ga0495637_0034884 3300046520 Bacteria 2201
135 Ga0495668_0001254 3300046616 Bacteria 25404
136 Ga0495611_0000180 3300046648 Bacteria 45126
137 Ga0495687_001156 3300047443 Bacteria 25557
138 Ga0495686_0000102 3300047472 Bacteria 177525
139 Ga0496121_0000028 3300048924 Bacteria 439193
140 Ga0496124_0068501 3300048927 Bacteria 2949
141 Ga0496126_0024514 3300048929 Bacteria 5824
142 Ga0501034_0008676 3300049571 Bacteria 10710
143 Ga0501034_0050637 3300049571 Bacteria 4189
144 Ga0501036_0056980 3300049572 Bacteria 3310
145 Ga0501043_0040630 3300049579 Bacteria 3656
146 Ga0501241_000837 3300049758 Bacteria 6545
147 Ga0501044_0023075 3300049823 Bacteria 6623
148 nmdc:mga0k408_2178_c1 3300050493 Bacteria 10512
149 nmdc:mga0qj67_45973_c1 3300050509 Bacteria 3445
150 Ga0500622_0002540 3300053156 Bacteria 13096

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046520 Ga0495637_0034884 Ga0495637_0034884_32_1891 619
2 3300049571 Ga0501034_0050637 Ga0501034_0050637_1962_4178 680
3 3300049572 Ga0501036_0056980 Ga0501036_0056980_1034_3250 680
4 3300049579 Ga0501043_0040630 Ga0501043_0040630_1303_3519 680
5 3300049823 Ga0501044_0023075 Ga0501044_0023075_3027_5243 680
6 3300025914 Ga0207671_10002015 Ga0207671_1000201518 686
7 3300025913 Ga0207695_10000133 Ga0207695_1000013364 690
8 3300005535 Ga0070684_100092798 Ga0070684_1000927982 691
9 3300009545 Ga0105237_10000922 Ga0105237_100009225 693
10 3300046507 Ga0495606_0022788 Ga0495606_0022788_519_2723 695
11 3300017792 Ga0163161_10000179 Ga0163161_1000017932 696
12 3300046648 Ga0495611_0000180 Ga0495611_0000180_34881_37091 698
13 3300010375 Ga0105239_10015133 Ga0105239_100151332 704
14 iso_pu_bacteria 2739367656 2739618175 704
15 3300033180 Ga0307510_10000492 Ga0307510_1000049210 706
16 iso_pu_bacteria 2945997725 2945998522 706
17 iso_pu_bacteria 2954016120 2954020986 706
18 iso_pu_bacteria 2857627736 2857630567 709
19 3300013104 Ga0157370_10001059 Ga0157370_100010595 713
20 iso_pu_bacteria 2739367663 2739646283 716
21 3300017792 Ga0163161_10000258 Ga0163161_1000025812 718
22 3300009093 Ga0105240_10000071 Ga0105240_1000007198 719
23 3300025913 Ga0207695_10000068 Ga0207695_1000006850 719
24 3300005366 Ga0070659_100001750 Ga0070659_1000017501 721
25 3300025932 Ga0207690_10001899 Ga0207690_100018991 721
26 3300046616 Ga0495668_0001254 Ga0495668_0001254_21524_23704 721
27 3300009093 Ga0105240_10000063 Ga0105240_1000006394 725
28 3300009551 Ga0105238_10045431 Ga0105238_100454313 725
29 3300025912 Ga0207707_10043782 Ga0207707_100437823 738
30 3300028786 Ga0307517_10002277 Ga0307517_1000227712 740
31 3300048924 Ga0496121_0000028 Ga0496121_0000028_237611_239902 743
32 3300049571 Ga0501034_0008676 Ga0501034_0008676_1522_3924 750
33 3300031251 Ga0265327_10001009 Ga0265327_1000100922 751
34 3300048927 Ga0496124_0068501 Ga0496124_0068501_377_2707 751
35 3300013308 Ga0157375_10005988 Ga0157375_100059884 753
36 3300050493 nmdc:mga0k408_2178_c1 nmdc:mga0k408_2178_c1_5889_8282 753
37 3300009545 Ga0105237_10006236 Ga0105237_100062362 754
38 3300009551 Ga0105238_10017856 Ga0105238_100178563 754
39 3300010375 Ga0105239_10000040 Ga0105239_10000040144 754
40 3300025914 Ga0207671_10005416 Ga0207671_100054162 754
41 3300005327 Ga0070658_10000091 Ga0070658_100000912 760
42 3300009093 Ga0105240_10070913 Ga0105240_100709132 760
43 3300025909 Ga0207705_10000132 Ga0207705_100001322 760
44 3300009093 Ga0105240_10003631 Ga0105240_100036315 762
45 3300025913 Ga0207695_10015222 Ga0207695_100152223 762
46 3300013102 Ga0157371_10012966 Ga0157371_100129663 763
47 3300010375 Ga0105239_10030941 Ga0105239_100309412 764
48 3300013308 Ga0157375_10003434 Ga0157375_100034344 764
49 3300025295 Ga0209564_1001936 Ga0209564_10019368 764
50 3300025297 Ga0209758_1002575 Ga0209758_10025757 764
51 3300025931 Ga0207644_10009285 Ga0207644_100092853 764
52 3300047443 Ga0495687_001156 Ga0495687_001156_17715_20027 764
53 iso_pu_bacteria 2929154850 2929160050 765
54 3300005841 Ga0068863_100014348 Ga0068863_1000143483 767
55 3300003316 rootH1_10014780 rootH1_100147805 768
56 3300037312 Ga0395899_0000629 Ga0395899_0000629_21765_24098 768
57 3300037418 Ga0395900_0000480 Ga0395900_0000480_24829_27162 768
58 3300037466 Ga0395898_0006652 Ga0395898_0006652_4272_6605 768
59 3300037471 Ga0395905_0000738 Ga0395905_0000738_15934_18267 768
60 3300038443 Ga0395901_0000853 Ga0395901_0000853_2507_4840 768
61 3300053156 Ga0500622_0002540 Ga0500622_0002540_8909_11215 768
62 3300003794 Ga0055531_10000068 Ga0055531_1000006857 769
63 3300004803 Ga0058862_12687063 Ga0058862_126870631 769
64 3300005336 Ga0070680_100005010 Ga0070680_10000501011 769
65 3300013306 Ga0163162_10000032 Ga0163162_1000003235 769
66 3300025304 Ga0209257_1000001 Ga0209257_1000001508 769
67 3300025917 Ga0207660_10052143 Ga0207660_100521431 769
68 3300025921 Ga0207652_10059536 Ga0207652_100595362 769
69 3300026041 Ga0207639_10007594 Ga0207639_100075943 769
70 3300048929 Ga0496126_0024514 Ga0496126_0024514_381_2699 769
71 3300049758 Ga0501241_000837 Ga0501241_000837_2732_5053 770
72 3300001990 JGI24737J22298_10003388 JGI24737J22298_100033883 771
73 3300003320 rootH2_10001891 rootH2_10001891204 771
74 3300005457 Ga0070662_100000045 Ga0070662_10000004518 771
75 3300009174 Ga0105241_10000086 Ga0105241_1000008658 771
76 3300010375 Ga0105239_10114490 Ga0105239_101144901 771
77 3300013296 Ga0157374_10000128 Ga0157374_100001281 771
78 3300013307 Ga0157372_10017186 Ga0157372_100171865 771
79 3300025904 Ga0207647_10000511 Ga0207647_1000051110 771
80 3300025911 Ga0207654_10003772 Ga0207654_100037728 771
81 3300025933 Ga0207706_10000120 Ga0207706_1000012047 771
82 3300005548 Ga0070665_100000020 Ga0070665_100000020213 772
83 3300028379 Ga0268266_10000018 Ga0268266_10000018290 772
84 3300047472 Ga0495686_0000102 Ga0495686_0000102_140403_142736 772
85 3300003323 rootH1_10014018 rootH1_1001401814 773
86 3300013100 Ga0157373_10000083 Ga0157373_1000008334 773
87 3300013307 Ga0157372_10006836 Ga0157372_100068363 773
88 3300025250 Ga0209026_1000348 Ga0209026_100034813 773
89 3300005466 Ga0070685_10022223 Ga0070685_100222231 774
90 3300025908 Ga0207643_10018542 Ga0207643_100185421 774
91 3300037471 Ga0395905_0000612 Ga0395905_0000612_7992_10322 776
92 iso_pu_bacteria 2911138879 2911140955 776
93 3300005327 Ga0070658_10029768 Ga0070658_100297684 777
94 3300005328 Ga0070676_10009631 Ga0070676_100096315 777
95 3300005364 Ga0070673_100000400 Ga0070673_1000004002 777
96 3300005456 Ga0070678_100007009 Ga0070678_1000070095 777
97 3300005459 Ga0068867_100004573 Ga0068867_1000045739 777
98 3300005616 Ga0068852_100001345 Ga0068852_1000013458 777
99 3300006237 Ga0097621_100004382 Ga0097621_1000043826 777
100 3300006358 Ga0068871_100000100 Ga0068871_10000010015 777
101 3300006881 Ga0068865_100000174 Ga0068865_10000017414 777
102 3300009093 Ga0105240_10001351 Ga0105240_1000135115 777
103 3300009174 Ga0105241_10011345 Ga0105241_100113453 777
104 3300009545 Ga0105237_10001169 Ga0105237_1000116914 777
105 3300013296 Ga0157374_10000202 Ga0157374_1000020222 777
106 3300025907 Ga0207645_10000874 Ga0207645_100008745 777
107 3300025911 Ga0207654_10010382 Ga0207654_100103823 777
108 3300025913 Ga0207695_10001232 Ga0207695_1000123214 777
109 3300025914 Ga0207671_10006852 Ga0207671_100068526 777
110 3300025934 Ga0207686_10007373 Ga0207686_100073731 777
111 3300025938 Ga0207704_10000099 Ga0207704_1000009920 777
112 3300025960 Ga0207651_10014877 Ga0207651_100148772 777
113 3300026023 Ga0207677_10047002 Ga0207677_100470022 777
114 3300026089 Ga0207648_10023973 Ga0207648_100239731 777
115 3300026142 Ga0207698_10022785 Ga0207698_100227853 777
116 3300003322 rootL2_10138024 rootL2_101380242 778
117 3300003354 JGI25160J50197_1000702 JGI25160J50197_10007028 778
118 3300003771 Ga0055526_1006464 Ga0055526_10064642 778
119 3300003790 Ga0055528_1002201 Ga0055528_10022015 778
120 3300003791 Ga0055530_10000570 Ga0055530_1000057013 778
121 3300005262 Ga0065165_1000012 Ga0065165_1000012201 778
122 3300025273 Ga0209673_1000016 Ga0209673_1000016369 778
123 3300025273 Ga0209673_1000111 Ga0209673_100011175 778
124 3300025295 Ga0209564_1001725 Ga0209564_100172511 778
125 3300025297 Ga0209758_1010772 Ga0209758_10107723 778
126 3300025298 Ga0209050_1000444 Ga0209050_100044432 778
127 3300025302 Ga0207426_1000606 Ga0207426_100060628 778
128 3300025304 Ga0209257_1004163 Ga0209257_10041639 778
129 3300050509 nmdc:mga0qj67_45973_c1 nmdc:mga0qj67_45973_c1_1080_3431 778
130 3300005337 Ga0070682_100030611 Ga0070682_1000306112 779
131 3300005471 Ga0070698_100000219 Ga0070698_1000002197 779
132 3300028786 Ga0307517_10004683 Ga0307517_100046836 779
133 3300033180 Ga0307510_10002326 Ga0307510_100023264 779
134 3300005466 Ga0070685_10003391 Ga0070685_100033919 780
135 3300005471 Ga0070698_100005876 Ga0070698_1000058769 780
136 3300005471 Ga0070698_100031124 Ga0070698_1000311245 780
137 3300005614 Ga0068856_100000899 Ga0068856_1000008993 780
138 3300009176 Ga0105242_10002305 Ga0105242_1000230512 780
139 3300013306 Ga0163162_10020083 Ga0163162_100200832 780
140 3300017792 Ga0163161_10017514 Ga0163161_100175144 780
141 3300025934 Ga0207686_10002640 Ga0207686_100026407 780
142 3300025961 Ga0207712_10002212 Ga0207712_100022125 780
143 3300026078 Ga0207702_10000507 Ga0207702_100005071 780
144 3300026088 Ga0207641_10000371 Ga0207641_1000037116 780
145 3300026088 Ga0207641_10009558 Ga0207641_100095583 780
146 3300031730 Ga0307516_10003984 Ga0307516_100039842 780
147 iso_pu_bacteria 2929921140 2929924205 781
148 3300002459 JGI24751J29686_10001500 JGI24751J29686_100015002 782
149 3300005577 Ga0068857_100053888 Ga0068857_1000538882 782
150 3300025914 Ga0207671_10005309 Ga0207671_1000530911 782
151 iso_pu_bacteria 8003151029 8003156067 782
152 3300044658 Ga0466972_0000021 Ga0466972_0000021_89590_91947 783
153 3300044765 Ga0466970_0000749 Ga0466970_0000749_6674_9031 783
154 3300002738 JGI25154J39366_1000227 JGI25154J39366_10002272 797
155 3300003215 JGI25153J46596_10003831 JGI25153J46596_100038313 797
156 3300025246 Ga0209646_1000009 Ga0209646_10000092 797
157 3300025250 Ga0209026_1000188 Ga0209026_10001882 797
158 3300025297 Ga0209758_1010704 Ga0209758_10107043 797
159 3300001979 JGI24740J21852_10003830 JGI24740J21852_100038303 824

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00326

Peptidase_S9

Prolyl oligopeptidase family

598

802

0.96

PF00930

DPPIV_N

Dipeptidyl peptidase IV (DPP IV) N-terminal region

155

518

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wyd-assembly1.cif.gz_B c-terminal esterase domain of lc-est1 0.7803 564 791
2dcm-assembly1.cif.gz_A the crystal structure of s603a mutated prolyl tripeptidyl aminopeptidase complexed with substrate 0.7735 86 798
4ao8-assembly1.cif.gz_A-2 peg-bound complex of a novel cold-adapted esterase from an arctic intertidal metagenomic library 0.7733 547 798
2dcm-assembly1.cif.gz_A the crystal structure of s603a mutated prolyl tripeptidyl aminopeptidase complexed with substrate 0.7714 86 798
2z3w-assembly1.cif.gz_A-2 prolyl tripeptidyl aminopeptidase mutant e636a 0.7713 88 798
ID Description Score Start End Superfamily
2ecfA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8448 544 798 3.40.50.1820
af_H2KZK7_662_918_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8441 548 798 3.40.50.1820
2z3wA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8437 548 798 3.40.50.1820
4wjlB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8338 548 798 3.40.50.1820
af_M0R781_602_862_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8329 544 791 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A382RQT5-F1-model_v4 Dipeptidylpeptidase IV N-terminal domain-containing protein 0.9395 323 638 GO:0006508
AF-A0A2V7RTS0-F1-model_v4 S9 family peptidase 0.9372 450 625 GO:0006508
AF-A0A382RQT5-F1-model_v4 Dipeptidylpeptidase IV N-terminal domain-containing protein 0.931 323 638 GO:0006508
AF-A0A519YPF8-F1-model_v4 S9 family peptidase 0.9258 410 711 GO:0006508
GO:0008236
AF-A0A349N6G2-F1-model_v4 S9 family peptidase 0.9206 359 807 GO:0006508
GO:0008236

Feature Viewer

pLDDT pTM Quality
79.26 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map