F228646

General Info

Members Datasets Scaffolds Average Seq Length
158 121 316 210

Family's Representative Sequence

Representative Sequence 3300002737|JGI25162J39368_1006178|JGI25162J39368_10061782
Length 201
Sequence MIELNEIPNHIASQLLKIKAVALRPQQPFTWTSGIKSPIYCDNRLTMSYPEIRNDIAEAFATIIRNQYPEAEVIAGTATAGIPHAAWVAQKLNLPMAYIRDKAKGHGKENLIEGLIAEGQKVVVKAAEAVRVAGATPLAVLAIFSYQLDKGVKAFEDAGIPLQTLSNYTALMDVALAQGTIQESDFELLKSWREDPSSFGK

Samples

Sample ID Description Type Environment
1 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
4 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
5 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
6 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
7 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
8 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
9 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
10 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
11 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
12 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
13 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
14 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
15 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
16 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
18 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
19 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
20 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
21 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
22 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
23 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
24 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
25 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
26 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
27 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
28 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
29 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
30 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
31 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
32 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
33 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
34 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
35 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
36 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
37 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
38 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
39 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
40 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
41 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
42 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
43 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
44 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
45 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
46 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
47 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
48 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
49 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
50 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
51 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
52 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
53 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
54 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
55 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
56 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
57 2671180694 Paenibacillus sp. A3 Isolate Unclassified
58 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
59 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
60 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
61 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
62 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
63 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
64 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
65 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
66 2818991459 Paenibacillus sp. 597 Isolate Unclassified
67 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
68 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
69 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
70 2857472729 Cohnella sp. R-74144 Isolate Unclassified
71 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
72 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
73 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
74 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
75 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
76 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
77 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
78 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
79 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
80 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
81 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
82 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
83 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
84 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
85 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
86 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
87 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
88 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
89 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
90 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
91 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
92 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
93 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
94 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
95 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
96 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
97 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
98 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
99 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
100 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
101 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
102 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
103 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
104 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
105 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
106 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
107 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
108 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
109 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
110 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
111 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
112 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
113 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
114 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
115 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
116 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
117 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
118 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
119 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
120 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere
121 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 49.37
Metatranscriptomes 0
Isolates 50.63

Biome Distribution

Category Percentage (%)
Aerial Root 1.27
Bulb 0
Endosphere 12.03
Nodule 0.63
Rhizoplane 1.27
Rhizosphere 40.51
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1006178 3300002737 Bacteria 2130
2 JGI25151J46595_10034041 3300003187 Bacteria 1953
3 JGI25151J46595_10075345 3300003187 Bacteria 1001
4 Ga0055538_1000554 3300003751 Bacteria 12905
5 Ga0055535_1002092 3300003761 Bacteria 7953
6 Ga0055541_1001528 3300003841 Bacteria 4976
7 Ga0055541_1010340 3300003841 Bacteria 1409
8 Ga0105251_10053144 3300009011 Bacteria 1926
9 Ga0105244_10003880 3300009036 Bacteria 10515
10 Ga0105244_10042822 3300009036 Bacteria 2338
11 Ga0105246_10005222 3300011119 Bacteria 7899
12 Ga0209784_100401 3300025224 Bacteria 19661
13 Ga0209784_101583 3300025224 Bacteria 2858
14 Ga0209566_100058 3300025225 Bacteria 201317
15 Ga0209566_100184 3300025225 Bacteria 66408
16 Ga0209566_100393 3300025225 Bacteria 35266
17 Ga0209147_100082 3300025229 Bacteria 194153
18 Ga0209437_100562 3300025233 Bacteria 24419
19 Ga0209258_102285 3300025242 Bacteria 5119
20 Ga0209675_1008075 3300025291 Bacteria 3928
21 Ga0209025_1005095 3300025294 Bacteria 10928
22 Ga0209025_1005494 3300025294 Bacteria 10311
23 Ga0209025_1013768 3300025294 Bacteria 5050
24 Ga0207655_1030261 3300025728 Bacteria 2520
25 Ga0395899_0025665 3300037312 Bacteria 4447
26 Ga0395899_0045083 3300037312 Bacteria 3285
27 Ga0395899_0289252 3300037312 Bacteria 1112
28 Ga0439436_0003396 3300041404 Bacteria 4831
29 Ga0439439_0040831 3300041406 Bacteria 1202
30 Ga0439433_0005405 3300041999 Bacteria 2744
31 Ga0439449_0000098 3300042007 Bacteria 27750
32 Ga0439449_0058005 3300042007 Bacteria 1429
33 Ga0439462_0001939 3300042015 Bacteria 4722
34 Ga0466969_0017257 3300044656 Bacteria 3771
35 Ga0466961_0042312 3300044693 Bacteria 2920
36 Ga0466959_0002253 3300045049 Bacteria 12292
37 Ga0495627_130686 3300046453 Bacteria 706
38 Ga0495606_0112464 3300046507 Bacteria 1641
39 Ga0495661_0089164 3300046665 Bacteria 1759
40 Ga0495661_0128141 3300046665 Bacteria 1394
41 Ga0495660_0188472 3300046810 Bacteria 993
42 Ga0496110_0000685 3300048913 Bacteria 23314
43 Ga0496116_0005391 3300048919 Bacteria 11898
44 Ga0496116_0009975 3300048919 Bacteria 8023
45 Ga0496116_0010566 3300048919 Bacteria 7721
46 Ga0496116_0065514 3300048919 Bacteria 2330
47 Ga0496116_0091662 3300048919 Bacteria 1846
48 Ga0496116_0190639 3300048919 Bacteria 1085
49 Ga0496117_0011509 3300048920 Bacteria 7919
50 Ga0496118_0021391 3300048921 Bacteria 5693
51 Ga0496119_0001503 3300048922 Bacteria 27877
52 Ga0496119_0004374 3300048922 Bacteria 14102
53 Ga0496120_0000215 3300048923 Bacteria 99455
54 Ga0496120_0066080 3300048923 Bacteria 2001
55 Ga0496121_0064449 3300048924 Bacteria 2988
56 Ga0496121_0106393 3300048924 Bacteria 2150
57 Ga0496121_0127968 3300048924 Bacteria 1906
58 Ga0496121_0181133 3300048924 Bacteria 1520
59 Ga0496122_0002091 3300048925 Bacteria 29584
60 Ga0496122_0038271 3300048925 Bacteria 3846
61 Ga0496122_0043877 3300048925 Bacteria 3498
62 Ga0496122_0068362 3300048925 Bacteria 2551
63 Ga0496122_0097455 3300048925 Bacteria 1979
64 Ga0496122_0156370 3300048925 Bacteria 1398
65 Ga0496122_0267207 3300048925 Bacteria 945
66 Ga0496123_0018062 3300048926 Bacteria 5639
67 Ga0496124_0000368 3300048927 Bacteria 82338
68 Ga0496124_0001059 3300048927 Bacteria 43414
69 Ga0496124_0020567 3300048927 Bacteria 6093
70 Ga0496124_0024182 3300048927 Bacteria 5530
71 Ga0496125_0001336 3300048928 Bacteria 36363
72 Ga0496125_0001763 3300048928 Bacteria 30006
73 Ga0496125_0180568 3300048928 Bacteria 1407
74 Ga0496125_0197925 3300048928 Bacteria 1319
75 Ga0496126_0000749 3300048929 Bacteria 58862
76 Ga0496126_0005813 3300048929 Bacteria 13942
77 Ga0496126_0076205 3300048929 Bacteria 2975
78 Ga0501217_071982 3300049661 Bacteria 942
79 2512734855 2512564039 Bacteria 8739048
80 2524186543 2524023129 Bacteria 6762600
81 2550906276 2548877040 Bacteria 7507281
82 2563927016 2563366752 Bacteria 4961801
83 2571530717 2571042143 Bacteria 6986194
84 2573037415 2571042588 Bacteria 5045676
85 2578337976 2576861424 Bacteria 5270569
86 2580932924 2579778775 Bacteria 5360914
87 2587737853 2585428059 Bacteria 8696589
88 2595316507 2593339198 Bacteria 7267884
89 2601639082 2600255286 Bacteria 5390125
90 2621276348 2619619294 Bacteria 5575484
91 2643738054 2643221543 Bacteria 6628015
92 2644423060 2643221676 Bacteria 8119172
93 2673821817 2671180694 Bacteria 7506943
94 2723604950 2721755693 Bacteria 6126117
95 2728534269 2728368933 Bacteria 7044283
96 2730135594 2728369359 Bacteria 5621728
97 2745169048 2744054657 Bacteria 5016802
98 2753811003 2751185905 Bacteria 6142767
99 2793184645 2791355222 Bacteria 5898266
100 2802437264 2802428803 Bacteria 5806948
101 2817619632 2816332336 Bacteria 5207640
102 2819670487 2818991459 Bacteria 8736032
103 2821114647 2821111986 Bacteria 6894338
104 2857459409 2857453340 Bacteria 8090534
105 2857462154 2857460504 Bacteria 5194327
106 2857473510 2857472729 Bacteria 6568124
107 2864739089 2864733723 Bacteria 6770668
108 2864999905 2864997549 Bacteria 5139696
109 2865003498 2865002811 Bacteria 6333767
110 2881640900 2881636855 Bacteria 5205297
111 2885527995 2885526491 Bacteria 7164189
112 2888580981 2888578766 Bacteria 6743310
113 2889046805 2889042446 Bacteria 7618936
114 2889050336 2889049205 Bacteria 7524325
115 2889280862 2889276214 Bacteria 5979355
116 2889296173 2889295896 Bacteria 4704906
117 2904114808 2904113452 Bacteria 7796941
118 2904163222 2904162308 Bacteria 7086713
119 2904493711 2904490793 Bacteria 7046938
120 2904598359 2904595352 Bacteria 6124848
121 2904760144 2904755435 Bacteria 7986759
122 2907205743 2907202186 Bacteria 6632024
123 2919162791 2919160200 Bacteria 6929020
124 2919427208 2919425241 Bacteria 8055701
125 2925326933 2925326138 Bacteria 9652120
126 2929210549 2929206907 Bacteria 5918291
127 2931390253 2931384279 Bacteria 7299545
128 2938650160 2938649242 Bacteria 7118381
129 2939679727 2939679117 Bacteria 6921672
130 2939704608 2939702853 Bacteria 5139229
131 2945997522 2945991243 Bacteria 7008369
132 2946053733 2946053406 Bacteria 6978655
133 2968564019 2968558590 Bacteria 6956864
134 2971407204 2971403814 Bacteria 7370929
135 2971417248 2971410472 Bacteria 8311090
136 2971512574 2971511577 Bacteria 5404012
137 2980125772 2980125574 Bacteria 5567337
138 2980178223 2980176882 Bacteria 5397533
139 2981287916 2981284811 Bacteria 4641497
140 2981292371 2981289755 Bacteria 4641509
141 2981983535 2981980479 Bacteria 4641628
142 2981988427 2981985349 Bacteria 4641497
143 2984530318 2984527788 Bacteria 5288478
144 2984536426 2984532647 Bacteria 5288506
145 2988228567 2988225383 Bacteria 7221625
146 2996635950 2996632988 Bacteria 6921523
147 2996712509 2996706504 Bacteria 5757485
148 648171019 648028048 Bacteria 5394884
149 8002323236 8002317523 Bacteria 8051857
150 8046997642 8046991243 Bacteria 8497463
151 8054470178 8054465665 Bacteria 7323556
152 8054798089 8054795415 Bacteria 9785225
153 8055635095 8055632911 Bacteria 5283357
154 8056539956 8056533031 Bacteria 8964429
155 8057473788 8057473075 Bacteria 5892720
156 8057476238 8057473075 Bacteria 5892720
157 8057737651 8057733483 Bacteria 6578323
158 8057979077 8057977335 Bacteria 5694872
159 JGI25162J39368_1006178
160 JGI25151J46595_10034041
161 JGI25151J46595_10075345
162 Ga0055538_1000554
163 Ga0055535_1002092
164 Ga0055541_1001528
165 Ga0055541_1010340
166 Ga0105251_10053144
167 Ga0105244_10003880
168 Ga0105244_10042822
169 Ga0105246_10005222
170 Ga0209784_100401
171 Ga0209784_101583
172 Ga0209566_100058
173 Ga0209566_100184
174 Ga0209566_100393
175 Ga0209147_100082
176 Ga0209437_100562
177 Ga0209258_102285
178 Ga0209675_1008075
179 Ga0209025_1005095
180 Ga0209025_1005494
181 Ga0209025_1013768
182 Ga0207655_1030261
183 Ga0395899_0025665
184 Ga0395899_0045083
185 Ga0395899_0289252
186 Ga0439436_0003396
187 Ga0439439_0040831
188 Ga0439433_0005405
189 Ga0439449_0000098
190 Ga0439449_0058005
191 Ga0439462_0001939
192 Ga0466969_0017257
193 Ga0466961_0042312
194 Ga0466959_0002253
195 Ga0495627_130686
196 Ga0495606_0112464
197 Ga0495661_0089164
198 Ga0495661_0128141
199 Ga0495660_0188472
200 Ga0496110_0000685
201 Ga0496116_0005391
202 Ga0496116_0009975
203 Ga0496116_0010566
204 Ga0496116_0065514
205 Ga0496116_0091662
206 Ga0496116_0190639
207 Ga0496117_0011509
208 Ga0496118_0021391
209 Ga0496119_0001503
210 Ga0496119_0004374
211 Ga0496120_0000215
212 Ga0496120_0066080
213 Ga0496121_0064449
214 Ga0496121_0106393
215 Ga0496121_0127968
216 Ga0496121_0181133
217 Ga0496122_0002091
218 Ga0496122_0038271
219 Ga0496122_0043877
220 Ga0496122_0068362
221 Ga0496122_0097455
222 Ga0496122_0156370
223 Ga0496122_0267207
224 Ga0496123_0018062
225 Ga0496124_0000368
226 Ga0496124_0001059
227 Ga0496124_0020567
228 Ga0496124_0024182
229 Ga0496125_0001336
230 Ga0496125_0001763
231 Ga0496125_0180568
232 Ga0496125_0197925
233 Ga0496126_0000749
234 Ga0496126_0005813
235 Ga0496126_0076205
236 Ga0501217_071982
237 2512734855
238 2524186543
239 2550906276
240 2563927016
241 2571530717
242 2573037415
243 2578337976
244 2580932924
245 2587737853
246 2595316507
247 2601639082
248 2621276348
249 2643738054
250 2644423060
251 2673821817
252 2723604950
253 2728534269
254 2730135594
255 2745169048
256 2753811003
257 2793184645
258 2802437264
259 2817619632
260 2819670487
261 2821114647
262 2857459409
263 2857462154
264 2857473510
265 2864739089
266 2864999905
267 2865003498
268 2881640900
269 2885527995
270 2888580981
271 2889046805
272 2889050336
273 2889280862
274 2889296173
275 2904114808
276 2904163222
277 2904493711
278 2904598359
279 2904760144
280 2907205743
281 2919162791
282 2919427208
283 2925326933
284 2929210549
285 2931390253
286 2938650160
287 2939679727
288 2939704608
289 2945997522
290 2946053733
291 2968564019
292 2971407204
293 2971417248
294 2971512574
295 2980125772
296 2980178223
297 2981287916
298 2981292371
299 2981983535
300 2981988427
301 2984530318
302 2984536426
303 2988228567
304 2996635950
305 2996712509
306 648171019
307 8002323236
308 8046997642
309 8054470178
310 8054798089
311 8055635095
312 8056539956
313 8057473788
314 8057476238
315 8057737651
316 8057979077

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2aee-assembly1.cif.gz_A crystal structure of orotate phosphoribosyltransferase from streptococcus pyogenes 0.9355 7 199
2aee-assembly1.cif.gz_B crystal structure of orotate phosphoribosyltransferase from streptococcus pyogenes 0.9238 7 201
4rv4-assembly1.cif.gz_A 2.65 angstrom resolution crystal structure of an orotate phosphoribosyltransferase from bacillus anthracis str. 'ames ancestor' in complex with 5-phospho-alpha-d-ribosyl diphosphate (prpp) 0.9155 5 200
3dez-assembly1.cif.gz_B crystal structure of orotate phosphoribosyltransferase from streptococcus mutans 0.9126 7 199
4rv4-assembly1.cif.gz_B 2.65 angstrom resolution crystal structure of an orotate phosphoribosyltransferase from bacillus anthracis str. 'ames ancestor' in complex with 5-phospho-alpha-d-ribosyl diphosphate (prpp) 0.9121 4 200
ID Description Score Start End Superfamily
4rv4B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9121 4 200 3.40.50.2020
4rv4B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8902 4 200 3.40.50.2020
4ohcC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.878 3 199 3.40.50.2020
4ohcC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8573 3 199 3.40.50.2020
af_Q4DBC5_255_457_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8532 9 198 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A3C2EG42-F1-model_v4 Orotate phosphoribosyltransferase 0.9777 138 201 GO:0016757
AF-A0A2X2SNL1-F1-model_v4 Orotate phosphoribosyltransferase (EC 2.4.2.10) 0.9688 128 201 GO:0004588
AF-V9G5W3-F1-model_v4 Orotate phosphoribosyltransferase 0.9618 1 86 GO:0004588
GO:0006222
GO:0019856
AF-A0A662BBA6-F1-model_v4 Orotate phosphoribosyltransferase 0.9563 130 199 GO:0016757
AF-A0A4U3ANA4-F1-model_v4 deleted 0.9546 30 101

Map