F228221

General Info

Members Datasets Scaffolds Average Seq Length
157 105 314 124

Family's Representative Sequence

Representative Sequence 3300048927|Ga0496124_0227265|Ga0496124_0227265_347_760
Length 137
Sequence MNVVDSSGWLEYFADGPNAPCFAPALEKIEELVVPTVSIYEVFKRILQQRDEATALQAAALMHQGEVVSLTAPLALNAARLSRTLALPMADSIMLATATARDAVLWTQDADFAPIPGIKYVAKVKWITSRLNSSARR

Samples

Sample ID Description Type Environment
1 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
41 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
54 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
74 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
75 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
76 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
77 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
80 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
81 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
82 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
83 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
84 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
85 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
86 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
87 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
88 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
89 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
90 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
91 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
92 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
93 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
94 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
95 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
96 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
97 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
98 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
99 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
100 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
101 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
102 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
103 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
104 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
105 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.91
Nodule 0
Rhizoplane 1.91
Rhizosphere 91.72
Stem 0
Stem Tuber 0
Unclassified 31.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496124_0227265 3300048927 Bacteria 1398
2 Ga0070676_10171327 3300005328 Bacteria 1404
3 Ga0070670_100084638 3300005331 Unclassified 2725
4 Ga0068869_100057299 3300005334 Bacteria 2844
5 Ga0070680_100263604 3300005336 Bacteria 1458
6 Ga0070682_100000002 3300005337 Bacteria 506802
7 Ga0068868_100687584 3300005338 Unclassified 914
8 Ga0070675_100238699 3300005354 Unclassified 1588
9 Ga0070688_100122682 3300005365 Unclassified 1743
10 Ga0070701_10011175 3300005438 Bacteria 4002
11 Ga0070701_10138607 3300005438 Unclassified 1389
12 Ga0070711_100003137 3300005439 Bacteria 9583
13 Ga0070700_101854643 3300005441 Bacteria 520
14 Ga0070708_100458264 3300005445 Bacteria 1203
15 Ga0068867_100062537 3300005459 Bacteria 2766
16 Ga0070685_10034355 3300005466 Bacteria 2855
17 Ga0070706_100008542 3300005467 Bacteria 9546
18 Ga0070706_100008972 3300005467 Bacteria 9313
19 Ga0070706_100451145 3300005467 Bacteria 1197
20 Ga0070707_100004027 3300005468 Bacteria 13816
21 Ga0070707_100086304 3300005468 Unclassified 3035
22 Ga0070707_101884108 3300005468 Unclassified 565
23 Ga0070698_100037008 3300005471 Bacteria 5033
24 Ga0070699_100011396 3300005518 Bacteria 7676
25 Ga0070699_100089360 3300005518 Unclassified 2692
26 Ga0070697_100107312 3300005536 Unclassified 2323
27 Ga0070697_100282375 3300005536 Bacteria 1425
28 Ga0068853_100447752 3300005539 Bacteria 1214
29 Ga0070695_101675105 3300005545 Unclassified 532
30 Ga0070693_100182907 3300005547 Bacteria 1350
31 Ga0070704_100808277 3300005549 Unclassified 838
32 Ga0070664_101271059 3300005564 Unclassified 695
33 Ga0068857_100065416 3300005577 Bacteria 3233
34 Ga0068857_100252835 3300005577 Bacteria 1616
35 Ga0070702_100274114 3300005615 Bacteria 1155
36 Ga0068859_100317770 3300005617 Unclassified 1651
37 Ga0068866_10608957 3300005718 Unclassified 738
38 Ga0068851_10477929 3300005834 Unclassified 744
39 Ga0068870_10097178 3300005840 Bacteria 1657
40 Ga0081538_10066658 3300005981 Unclassified 2016
41 Ga0070717_10000022 3300006028 Bacteria 161825
42 Ga0097621_100025505 3300006237 Bacteria 4626
43 Ga0097621_100185525 3300006237 Bacteria 1799
44 Ga0068871_100180843 3300006358 Bacteria 1812
45 Ga0068865_101373339 3300006881 Unclassified 630
46 Ga0075436_100737679 3300006914 Unclassified 731
47 Ga0097620_100317772 3300006931 Unclassified 1651
48 Ga0097620_102252871 3300006931 Unclassified 601
49 Ga0075435_100218318 3300007076 Bacteria 1619
50 Ga0075435_101003488 3300007076 Unclassified 729
51 Ga0099794_10510229 3300007265 Unclassified 633
52 Ga0105244_10411182 3300009036 Unclassified 622
53 Ga0114129_10744411 3300009147 Bacteria 1255
54 Ga0114129_11092673 3300009147 Unclassified 999
55 Ga0105242_10022954 3300009176 Bacteria 4915
56 Ga0105248_13112120 3300009177 Unclassified 528
57 Ga0105249_10114361 3300009553 Unclassified 2555
58 Ga0105249_10817640 3300009553 Bacteria 996
59 Ga0105239_12095969 3300010375 Bacteria 657
60 Ga0105246_10554246 3300011119 Bacteria 986
61 Ga0157369_10003738 3300013105 Bacteria 18080
62 Ga0157378_11028272 3300013297 Unclassified 859
63 Ga0157375_10002875 3300013308 Bacteria 14922
64 Ga0157380_10132975 3300014326 Bacteria 2125
65 Ga0157380_13465477 3300014326 Unclassified 505
66 Ga0157376_10074883 3300014969 Bacteria 2887
67 Ga0157376_10798116 3300014969 Bacteria 956
68 Ga0213876_10020402 3300021384 Bacteria 3502
69 Ga0213876_10437450 3300021384 Bacteria 696
70 Ga0207656_10342767 3300025321 Unclassified 745
71 Ga0207645_10284540 3300025907 Bacteria 1098
72 Ga0207643_10099292 3300025908 Bacteria 1706
73 Ga0207684_10019741 3300025910 Bacteria 5764
74 Ga0207684_10031379 3300025910 Bacteria 4520
75 Ga0207684_10107231 3300025910 Bacteria 2390
76 Ga0207684_10135247 3300025910 Bacteria 2116
77 Ga0207663_10003660 3300025916 Bacteria 7553
78 Ga0207646_10010419 3300025922 Bacteria 9089
79 Ga0207646_10082466 3300025922 Unclassified 2875
80 Ga0207646_11174109 3300025922 Unclassified 674
81 Ga0207650_10008758 3300025925 Bacteria 6913
82 Ga0207659_10151633 3300025926 Unclassified 1811
83 Ga0207686_10009849 3300025934 Bacteria 5195
84 Ga0207686_10112612 3300025934 Unclassified 1838
85 Ga0207670_10833443 3300025936 Unclassified 770
86 Ga0207665_10488683 3300025939 Unclassified 950
87 Ga0207691_10687709 3300025940 Bacteria 863
88 Ga0207689_10020748 3300025942 Bacteria 5525
89 Ga0207689_10845809 3300025942 Bacteria 772
90 Ga0207679_10593840 3300025945 Unclassified 997
91 Ga0207639_10550152 3300026041 Bacteria 1060
92 Ga0207708_11607779 3300026075 Bacteria 571
93 Ga0207648_10058534 3300026089 Bacteria 3360
94 Ga0207676_10209110 3300026095 Bacteria 1730
95 Ga0207676_11793798 3300026095 Bacteria 612
96 Ga0207674_10020009 3300026116 Bacteria 7242
97 Ga0207674_10113713 3300026116 Bacteria 2679
98 Ga0316575_10014598 3300031665 Bacteria 2952
99 Ga0316579_10002121 3300031691 Bacteria 7436
100 Ga0316579_10369716 3300031691 Unclassified 693
101 Ga0316576_10317161 3300031727 Bacteria 1163
102 Ga0316576_10526192 3300031727 Unclassified 868
103 Ga0316578_10027675 3300031728 Unclassified 3205
104 Ga0316578_10336535 3300031728 Bacteria 899
105 Ga0316577_10039877 3300031733 Bacteria 2626
106 Ga0316577_10073105 3300031733 Bacteria 1914
107 Ga0316577_10479059 3300031733 Bacteria 707
108 Ga0307416_100832071 3300032002 Unclassified 1020
109 Ga0316583_10254177 3300032133 Bacteria 609
110 Ga0316585_10029714 3300032137 Bacteria 1712
111 Ga0316580_10026313 3300032139 Bacteria 1799
112 Ga0316574_0142373 3300035398 Bacteria 1545
113 Ga0316582_0002113 3300036647 Bacteria 9177
114 Ga0316582_0099528 3300036647 Unclassified 1924
115 Ga0316582_0155671 3300036647 Unclassified 1546
116 Ga0316582_0159521 3300036647 Bacteria 1528
117 Ga0316584_0007160 3300036712 Bacteria 7604
118 Ga0316584_0037326 3300036712 Unclassified 3609
119 Ga0316584_0266013 3300036712 Bacteria 1249
120 Ga0316584_0288914 3300036712 Bacteria 1190
121 Ga0316584_0356038 3300036712 Bacteria 1050
122 Ga0316584_0377638 3300036712 Bacteria 1013
123 Ga0316584_0896722 3300036712 Unclassified 597
124 Ga0316581_0000118 3300037588 Bacteria 11327
125 Ga0316581_0023406 3300037588 Bacteria 1827
126 Ga0400486_06675 3300038742 Bacteria 4147
127 Ga0400489_43538 3300039093 Bacteria 41859
128 Ga0436365_0142219 3300039437 Bacteria 1530
129 Ga0436365_0162244 3300039437 Bacteria 5349
130 Ga0436360_1191356 3300039438 Bacteria 1400
131 Ga0436362_0722661 3300039453 Bacteria 733
132 Ga0451802_0162767 3300041460 Bacteria 592
133 Ga0451802_0294528 3300041460 Bacteria 2049
134 Ga0451577_0000370 3300042876 Bacteria 83806
135 Ga0451577_0363972 3300042876 Bacteria 1312
136 Ga0453683_0083789 3300044673 Bacteria 1998
137 Ga0453684_0001098 3300044712 Bacteria 85258
138 Ga0453684_0160328 3300044712 Bacteria 2661
139 Ga0453684_0505344 3300044712 Bacteria 1338
140 Ga0451576_0941899 3300045051 Bacteria 906
141 Ga0451576_1041652 3300045051 Bacteria 857
142 Ga0451576_1903339 3300045051 Bacteria 614
143 Ga0496114_1678207 3300048917 Bacteria 523
144 Ga0501290_086083 3300049513 Unclassified 542
145 Ga0501299_207379 3300049522 Bacteria 523
146 Ga0501079_0390903 3300049741 Bacteria 1091
147 nmdc:mga05p37_128515_c1 3300050507 Bacteria 3110
148 nmdc:mga05p37_307044_c1 3300050507 Unclassified 983
149 nmdc:mga0n895_418873_c1 3300050512 Unclassified 1354
150 nmdc:mga0rr50_1256_c1 3300050513 Bacteria 13795
151 nmdc:mga0rr50_36021_c1 3300050513 Bacteria 3559
152 nmdc:mga0rr50_951788_c1 3300050513 Unclassified 732
153 nmdc:mga08x19_1314471_c1 3300050514 Unclassified 512
154 nmdc:mga08x19_2100_c1 3300050514 Bacteria 12186
155 Ga0500568_0013250 3300053139 Bacteria 3761
156 Ga0500622_0004775 3300053156 Bacteria 8338
157 Ga0500622_0028089 3300053156 Unclassified 2962
158 Ga0496124_0227265
159 Ga0070676_10171327
160 Ga0070670_100084638
161 Ga0068869_100057299
162 Ga0070680_100263604
163 Ga0070682_100000002
164 Ga0068868_100687584
165 Ga0070675_100238699
166 Ga0070688_100122682
167 Ga0070701_10011175
168 Ga0070701_10138607
169 Ga0070711_100003137
170 Ga0070700_101854643
171 Ga0070708_100458264
172 Ga0068867_100062537
173 Ga0070685_10034355
174 Ga0070706_100008542
175 Ga0070706_100008972
176 Ga0070706_100451145
177 Ga0070707_100004027
178 Ga0070707_100086304
179 Ga0070707_101884108
180 Ga0070698_100037008
181 Ga0070699_100011396
182 Ga0070699_100089360
183 Ga0070697_100107312
184 Ga0070697_100282375
185 Ga0068853_100447752
186 Ga0070695_101675105
187 Ga0070693_100182907
188 Ga0070704_100808277
189 Ga0070664_101271059
190 Ga0068857_100065416
191 Ga0068857_100252835
192 Ga0070702_100274114
193 Ga0068859_100317770
194 Ga0068866_10608957
195 Ga0068851_10477929
196 Ga0068870_10097178
197 Ga0081538_10066658
198 Ga0070717_10000022
199 Ga0097621_100025505
200 Ga0097621_100185525
201 Ga0068871_100180843
202 Ga0068865_101373339
203 Ga0075436_100737679
204 Ga0097620_100317772
205 Ga0097620_102252871
206 Ga0075435_100218318
207 Ga0075435_101003488
208 Ga0099794_10510229
209 Ga0105244_10411182
210 Ga0114129_10744411
211 Ga0114129_11092673
212 Ga0105242_10022954
213 Ga0105248_13112120
214 Ga0105249_10114361
215 Ga0105249_10817640
216 Ga0105239_12095969
217 Ga0105246_10554246
218 Ga0157369_10003738
219 Ga0157378_11028272
220 Ga0157375_10002875
221 Ga0157380_10132975
222 Ga0157380_13465477
223 Ga0157376_10074883
224 Ga0157376_10798116
225 Ga0213876_10020402
226 Ga0213876_10437450
227 Ga0207656_10342767
228 Ga0207645_10284540
229 Ga0207643_10099292
230 Ga0207684_10019741
231 Ga0207684_10031379
232 Ga0207684_10107231
233 Ga0207684_10135247
234 Ga0207663_10003660
235 Ga0207646_10010419
236 Ga0207646_10082466
237 Ga0207646_11174109
238 Ga0207650_10008758
239 Ga0207659_10151633
240 Ga0207686_10009849
241 Ga0207686_10112612
242 Ga0207670_10833443
243 Ga0207665_10488683
244 Ga0207691_10687709
245 Ga0207689_10020748
246 Ga0207689_10845809
247 Ga0207679_10593840
248 Ga0207639_10550152
249 Ga0207708_11607779
250 Ga0207648_10058534
251 Ga0207676_10209110
252 Ga0207676_11793798
253 Ga0207674_10020009
254 Ga0207674_10113713
255 Ga0316575_10014598
256 Ga0316579_10002121
257 Ga0316579_10369716
258 Ga0316576_10317161
259 Ga0316576_10526192
260 Ga0316578_10027675
261 Ga0316578_10336535
262 Ga0316577_10039877
263 Ga0316577_10073105
264 Ga0316577_10479059
265 Ga0307416_100832071
266 Ga0316583_10254177
267 Ga0316585_10029714
268 Ga0316580_10026313
269 Ga0316574_0142373
270 Ga0316582_0002113
271 Ga0316582_0099528
272 Ga0316582_0155671
273 Ga0316582_0159521
274 Ga0316584_0007160
275 Ga0316584_0037326
276 Ga0316584_0266013
277 Ga0316584_0288914
278 Ga0316584_0356038
279 Ga0316584_0377638
280 Ga0316584_0896722
281 Ga0316581_0000118
282 Ga0316581_0023406
283 Ga0400486_06675
284 Ga0400489_43538
285 Ga0436365_0142219
286 Ga0436365_0162244
287 Ga0436360_1191356
288 Ga0436362_0722661
289 Ga0451802_0162767
290 Ga0451802_0294528
291 Ga0451577_0000370
292 Ga0451577_0363972
293 Ga0453683_0083789
294 Ga0453684_0001098
295 Ga0453684_0160328
296 Ga0453684_0505344
297 Ga0451576_0941899
298 Ga0451576_1041652
299 Ga0451576_1903339
300 Ga0496114_1678207
301 Ga0501290_086083
302 Ga0501299_207379
303 Ga0501079_0390903
304 nmdc:mga05p37_128515_c1
305 nmdc:mga05p37_307044_c1
306 nmdc:mga0n895_418873_c1
307 nmdc:mga0rr50_1256_c1
308 nmdc:mga0rr50_36021_c1
309 nmdc:mga0rr50_951788_c1
310 nmdc:mga08x19_1314471_c1
311 nmdc:mga08x19_2100_c1
312 Ga0500568_0013250
313 Ga0500622_0004775
314 Ga0500622_0028089

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

3

118

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xgr-assembly1.cif.gz_A crystal structure of addiction module from mycobacterial species 0.8892 1 116
7by2-assembly1.cif.gz_B-2 toxin-antitoxin complex from klebsiella pneumoniae 0.8842 1 119
7by2-assembly1.cif.gz_B-2 toxin-antitoxin complex from klebsiella pneumoniae 0.8431 1 119
4xgq-assembly2.cif.gz_G crystal structure of addiction module from mycobacterial species 0.8397 1 122
5x3t-assembly1.cif.gz_H vapbc from mycobacterium tuberculosis 0.8325 2 109
ID Description Score Start End Superfamily
af_P9WF81_1_130_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8626 3 119 3.40.50.1010
4xgqG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8397 1 122 3.40.50.1010
af_O53779_1_126_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8335 3 110 3.40.50.1010
af_P9WF57_1_130_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8331 3 116 3.40.50.1010
4xgqG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8155 1 122 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A2E3J8Q3-F1-model_v4 VapC toxin family PIN domain ribonuclease 1.001 1 124
AF-A0A0S8I9B9-F1-model_v4 Twitching motility protein PilT 0.9995 1 123
AF-A0A1G3AI27-F1-model_v4 Twitching motility protein PilT 0.998 1 108
AF-A0A1F6G9K4-F1-model_v4 Twitching motility protein PilT 0.9972 1 124
AF-A0A1E3XEH0-F1-model_v4 PilT domain-containing protein 0.9946 1 71

Map