F228172

General Info

Members Datasets Scaffolds Average Seq Length
157 108 314 295

Family's Representative Sequence

Representative Sequence 3300048909|Ga0496106_0090649|Ga0496106_0090649_1280_2332
Length 350
Sequence MGGLVLVGVPVPVGAVGPPRLGLVDRAALDPHALRQVVLHGATLLARRPSRLWQRGVVDFSELTPLTGGWSGQTFLAEAGGARSVVRIYRPGQRDDAGPEIDAAVLRLVRGIVAVPDVLEVRRGLAAADRPGLLVTSYVPGERGDLLLPTLDGHGLTVLGARLGSVAADLAGMPTLRSGEFVDGDLSIRPFQGIDGLPGFVDDHASALGWDETLLAGLRTVADQAQALLDTVGRTCLVHSDLNPKNLLVDAETLEVTGVLDWEFAHAGHPFTDLGNLLRFDRHPAYVDGVLAAFCERRGSTPAEALELARAADLWALVDLAARHGQNPVADRAHQHLVAVARTRDVHALP

Samples

Sample ID Description Type Environment
1 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
53 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
55 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
56 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
57 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
58 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
59 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
60 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
61 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
62 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
63 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
64 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
65 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
66 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
67 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
68 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
69 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
70 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
71 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
72 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
73 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
74 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
75 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
76 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
77 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
79 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
81 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
82 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
83 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
84 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
85 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
86 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
87 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
88 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
89 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
90 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
91 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
93 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
94 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
95 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
96 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
97 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
98 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
99 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
100 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
101 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
102 2643221641 Nocardioides sp. Root122 Isolate Unclassified
103 2739367898 Nocardioides sp. CF479 Isolate Unclassified
104 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
105 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
106 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
107 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
108 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.54
Metatranscriptomes 0
Isolates 4.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.56
Nodule 0.64
Rhizoplane 15.29
Rhizosphere 63.69
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496106_0090649 3300048909 Bacteria 2359
2 Ga0070658_10011002 3300005327 Bacteria 7253
3 Ga0070658_10217245 3300005327 Bacteria 1616
4 Ga0070683_100078648 3300005329 Bacteria 3085
5 Ga0068869_100146613 3300005334 Bacteria 1827
6 Ga0070680_100300108 3300005336 Bacteria 1362
7 Ga0070660_100067375 3300005339 Bacteria 2789
8 Ga0070692_10023116 3300005345 Bacteria 3043
9 Ga0070674_100108745 3300005356 Bacteria 2032
10 Ga0070667_100042786 3300005367 Bacteria 3800
11 Ga0070667_100159345 3300005367 Bacteria 1987
12 Ga0070707_100243875 3300005468 Bacteria 1749
13 Ga0070698_100027733 3300005471 Bacteria 5886
14 Ga0070679_100089853 3300005530 Bacteria 3059
15 Ga0070684_100058457 3300005535 Bacteria 3370
16 Ga0070684_100402029 3300005535 Bacteria 1263
17 Ga0068853_100178096 3300005539 Bacteria 1927
18 Ga0070686_100096426 3300005544 Bacteria 1989
19 Ga0068857_100019151 3300005577 Bacteria 6007
20 Ga0068854_100255411 3300005578 Bacteria 1401
21 Ga0068856_100295842 3300005614 Bacteria 1636
22 Ga0070702_100020428 3300005615 Bacteria 3470
23 Ga0068852_100185105 3300005616 Bacteria 1961
24 Ga0068852_100358959 3300005616 Bacteria 1425
25 Ga0068863_100072187 3300005841 Bacteria 3266
26 Ga0068860_100001520 3300005843 Bacteria 24976
27 Ga0075365_10051556 3300006038 Bacteria 2718
28 Ga0075365_10116935 3300006038 Bacteria 1836
29 Ga0075365_10270610 3300006038 Bacteria 1195
30 Ga0075363_100013338 3300006048 Bacteria 3979
31 Ga0075363_100030484 3300006048 Bacteria 2793
32 Ga0075364_10004645 3300006051 Bacteria 7921
33 Ga0075364_10007851 3300006051 Bacteria 6351
34 Ga0075364_10066949 3300006051 Bacteria 2360
35 Ga0075364_10121792 3300006051 Bacteria 1746
36 Ga0075370_10018862 3300006353 Bacteria 3746
37 Ga0075370_10027265 3300006353 Bacteria 3169
38 Ga0075370_10034324 3300006353 Bacteria 2844
39 Ga0105245_10002325 3300009098 Bacteria 17190
40 Ga0105243_10056607 3300009148 Bacteria 3119
41 Ga0105243_10288005 3300009148 Bacteria 1483
42 Ga0105248_10021684 3300009177 Bacteria 7116
43 Ga0105238_10078527 3300009551 Bacteria 3291
44 Ga0105249_10010096 3300009553 Bacteria 8287
45 Ga0105246_10000525 3300011119 Bacteria 20949
46 Ga0157369_10089726 3300013105 Bacteria 3282
47 Ga0157374_10295567 3300013296 Bacteria 1602
48 Ga0163162_10006314 3300013306 Bacteria 11477
49 Ga0157372_10005328 3300013307 Bacteria 13662
50 Ga0157375_10169397 3300013308 Bacteria 2331
51 Ga0163163_10043908 3300014325 Bacteria 4384
52 Ga0207647_10077809 3300025904 Bacteria 1993
53 Ga0207660_10308034 3300025917 Bacteria 1262
54 Ga0207657_10047818 3300025919 Bacteria 3737
55 Ga0207646_10188587 3300025922 Bacteria 1862
56 Ga0207687_10007967 3300025927 Bacteria 6936
57 Ga0207709_10108043 3300025935 Bacteria 1854
58 Ga0207661_10034964 3300025944 Bacteria 3912
59 Ga0207661_10177822 3300025944 Bacteria 1856
60 Ga0207667_10513963 3300025949 Bacteria 1214
61 Ga0207639_10256399 3300026041 Bacteria 1528
62 Ga0207702_10446197 3300026078 Bacteria 1255
63 Ga0207674_10023518 3300026116 Bacteria 6598
64 Ga0207675_100093237 3300026118 Bacteria 2833
65 Ga0207698_10310326 3300026142 Bacteria 1473
66 Ga0209813_10002892 3300027866 Bacteria 3973
67 Ga0268264_10006046 3300028381 Bacteria 10230
68 Ga0307413_10238424 3300031824 Bacteria 1341
69 Ga0307410_10165184 3300031852 Bacteria 1663
70 Ga0307410_10196680 3300031852 Bacteria 1537
71 Ga0307410_10214112 3300031852 Bacteria 1478
72 Ga0307407_10155990 3300031903 Bacteria 1489
73 Ga0307409_100375930 3300031995 Bacteria 1349
74 Ga0307416_100289416 3300032002 Bacteria 1621
75 Ga0466963_0029155 3300044694 Bacteria 3550
76 Ga0466963_0114599 3300044694 Bacteria 1852
77 Ga0466963_0189876 3300044694 Bacteria 1435
78 Ga0466957_0064108 3300044842 Bacteria 2260
79 Ga0451576_0397344 3300045051 Bacteria 1445
80 Ga0466967_0064341 3300045976 Bacteria 3261
81 Ga0466967_0103547 3300045976 Bacteria 2604
82 Ga0466967_0605325 3300045976 Bacteria 1082
83 Ga0466967_0621729 3300045976 Bacteria 1067
84 Ga0496100_0058526 3300048903 Bacteria 2529
85 Ga0496101_0071067 3300048904 Bacteria 2551
86 Ga0496101_0130586 3300048904 Bacteria 1908
87 Ga0496102_0050901 3300048905 Bacteria 3773
88 Ga0496102_0596832 3300048905 Bacteria 1027
89 Ga0496103_0086608 3300048906 Bacteria 1975
90 Ga0496105_0000529 3300048908 Bacteria 25230
91 Ga0496108_0081467 3300048911 Bacteria 2743
92 Ga0496109_0046929 3300048912 Bacteria 3925
93 Ga0496109_0094258 3300048912 Bacteria 2771
94 Ga0496109_0169532 3300048912 Bacteria 2047
95 Ga0496109_0327029 3300048912 Bacteria 1447
96 Ga0496109_0388969 3300048912 Bacteria 1318
97 Ga0496110_0101044 3300048913 Bacteria 2585
98 Ga0496110_0309578 3300048913 Bacteria 1439
99 Ga0496111_0008362 3300048914 Bacteria 6842
100 Ga0496113_0409522 3300048916 Bacteria 1089
101 Ga0496114_0001087 3300048917 Bacteria 20491
102 Ga0496114_0039824 3300048917 Bacteria 3889
103 Ga0496114_0043832 3300048917 Bacteria 3710
104 Ga0496114_0135870 3300048917 Bacteria 2126
105 Ga0496115_0010112 3300048918 Bacteria 7037
106 Ga0496115_0053107 3300048918 Bacteria 3252
107 Ga0501038_0216556 3300049574 Bacteria 1530
108 Ga0501039_0098471 3300049575 Bacteria 2281
109 Ga0501039_0477183 3300049575 Bacteria 979
110 Ga0501040_0106534 3300049576 Bacteria 1959
111 Ga0501042_0140908 3300049578 Bacteria 1739
112 Ga0501047_0191568 3300049581 Bacteria 1908
113 Ga0501067_0000719 3300049583 Bacteria 17849
114 Ga0501067_0081101 3300049583 Bacteria 1798
115 Ga0501068_0132132 3300049584 Bacteria 1561
116 Ga0501069_0146944 3300049585 Bacteria 1353
117 Ga0501070_0014771 3300049586 Bacteria 6569
118 Ga0501070_0017140 3300049586 Bacteria 6079
119 Ga0501070_0348004 3300049586 Bacteria 1203
120 Ga0501071_0222969 3300049587 Bacteria 1419
121 Ga0501071_0252940 3300049587 Bacteria 1330
122 Ga0501072_0094254 3300049588 Bacteria 2378
123 Ga0501072_0318707 3300049588 Bacteria 1235
124 Ga0501072_0424386 3300049588 Bacteria 1054
125 Ga0501073_0008561 3300049589 Bacteria 7585
126 Ga0501074_0001106 3300049590 Bacteria 17610
127 Ga0501074_0045056 3300049590 Bacteria 3191
128 Ga0501074_0340580 3300049590 Bacteria 1064
129 Ga0501079_0045978 3300049741 Bacteria 3368
130 Ga0501080_0002376 3300049742 Bacteria 16407
131 Ga0501080_0004392 3300049742 Bacteria 12529
132 Ga0501083_0008948 3300049744 Bacteria 7068
133 Ga0501035_0310102 3300049822 Bacteria 1328
134 Ga0501045_0316017 3300049824 Bacteria 1162
135 nmdc:mga03n38_150680_c1 3300050490 Bacteria 1170
136 nmdc:mga03n38_18325_c1 3300050490 Bacteria 2762
137 nmdc:mga03n38_3028_c1 3300050490 Bacteria 5324
138 nmdc:mga00v17_61194_c1 3300050491 Bacteria 2314
139 nmdc:mga00v17_87010_c1 3300050491 Bacteria 1959
140 nmdc:mga0yw44_270987_c1 3300050492 Bacteria 1133
141 nmdc:mga06z11_239332_c1 3300050494 Bacteria 1066
142 nmdc:mga06z11_5139_c1 3300050494 Bacteria 5218
143 nmdc:mga06z11_56866_c1 3300050494 Bacteria 2025
144 nmdc:mga06z11_96016_c1 3300050494 Bacteria 1618
145 nmdc:mga04h51_79201_c1 3300050495 Bacteria 1163
146 nmdc:mga07m45_4563_c1 3300050496 Bacteria 6783
147 Ga0500644_0000057 3300053088 Bacteria 66407
148 Ga0501084_0053758 3300054114 Bacteria 3368
149 Ga0501084_0183861 3300054114 Bacteria 1764
150 Ga0501082_0032938 3300060353 Bacteria 4469
151 2644230244 2643221641 Bacteria 4490190
152 2740169080 2739367898 Bacteria 4367674
153 2774396891 2773857762 Bacteria 5971770
154 2809198530 2808606439 Bacteria 5952208
155 2812352890 2811994878 Bacteria 5992952
156 2891969593 2891968417 Bacteria 5821697
157 8054611091 8054609563 Bacteria 5170090
158 Ga0496106_0090649
159 Ga0070658_10011002
160 Ga0070658_10217245
161 Ga0070683_100078648
162 Ga0068869_100146613
163 Ga0070680_100300108
164 Ga0070660_100067375
165 Ga0070692_10023116
166 Ga0070674_100108745
167 Ga0070667_100042786
168 Ga0070667_100159345
169 Ga0070707_100243875
170 Ga0070698_100027733
171 Ga0070679_100089853
172 Ga0070684_100058457
173 Ga0070684_100402029
174 Ga0068853_100178096
175 Ga0070686_100096426
176 Ga0068857_100019151
177 Ga0068854_100255411
178 Ga0068856_100295842
179 Ga0070702_100020428
180 Ga0068852_100185105
181 Ga0068852_100358959
182 Ga0068863_100072187
183 Ga0068860_100001520
184 Ga0075365_10051556
185 Ga0075365_10116935
186 Ga0075365_10270610
187 Ga0075363_100013338
188 Ga0075363_100030484
189 Ga0075364_10004645
190 Ga0075364_10007851
191 Ga0075364_10066949
192 Ga0075364_10121792
193 Ga0075370_10018862
194 Ga0075370_10027265
195 Ga0075370_10034324
196 Ga0105245_10002325
197 Ga0105243_10056607
198 Ga0105243_10288005
199 Ga0105248_10021684
200 Ga0105238_10078527
201 Ga0105249_10010096
202 Ga0105246_10000525
203 Ga0157369_10089726
204 Ga0157374_10295567
205 Ga0163162_10006314
206 Ga0157372_10005328
207 Ga0157375_10169397
208 Ga0163163_10043908
209 Ga0207647_10077809
210 Ga0207660_10308034
211 Ga0207657_10047818
212 Ga0207646_10188587
213 Ga0207687_10007967
214 Ga0207709_10108043
215 Ga0207661_10034964
216 Ga0207661_10177822
217 Ga0207667_10513963
218 Ga0207639_10256399
219 Ga0207702_10446197
220 Ga0207674_10023518
221 Ga0207675_100093237
222 Ga0207698_10310326
223 Ga0209813_10002892
224 Ga0268264_10006046
225 Ga0307413_10238424
226 Ga0307410_10165184
227 Ga0307410_10196680
228 Ga0307410_10214112
229 Ga0307407_10155990
230 Ga0307409_100375930
231 Ga0307416_100289416
232 Ga0466963_0029155
233 Ga0466963_0114599
234 Ga0466963_0189876
235 Ga0466957_0064108
236 Ga0451576_0397344
237 Ga0466967_0064341
238 Ga0466967_0103547
239 Ga0466967_0605325
240 Ga0466967_0621729
241 Ga0496100_0058526
242 Ga0496101_0071067
243 Ga0496101_0130586
244 Ga0496102_0050901
245 Ga0496102_0596832
246 Ga0496103_0086608
247 Ga0496105_0000529
248 Ga0496108_0081467
249 Ga0496109_0046929
250 Ga0496109_0094258
251 Ga0496109_0169532
252 Ga0496109_0327029
253 Ga0496109_0388969
254 Ga0496110_0101044
255 Ga0496110_0309578
256 Ga0496111_0008362
257 Ga0496113_0409522
258 Ga0496114_0001087
259 Ga0496114_0039824
260 Ga0496114_0043832
261 Ga0496114_0135870
262 Ga0496115_0010112
263 Ga0496115_0053107
264 Ga0501038_0216556
265 Ga0501039_0098471
266 Ga0501039_0477183
267 Ga0501040_0106534
268 Ga0501042_0140908
269 Ga0501047_0191568
270 Ga0501067_0000719
271 Ga0501067_0081101
272 Ga0501068_0132132
273 Ga0501069_0146944
274 Ga0501070_0014771
275 Ga0501070_0017140
276 Ga0501070_0348004
277 Ga0501071_0222969
278 Ga0501071_0252940
279 Ga0501072_0094254
280 Ga0501072_0318707
281 Ga0501072_0424386
282 Ga0501073_0008561
283 Ga0501074_0001106
284 Ga0501074_0045056
285 Ga0501074_0340580
286 Ga0501079_0045978
287 Ga0501080_0002376
288 Ga0501080_0004392
289 Ga0501083_0008948
290 Ga0501035_0310102
291 Ga0501045_0316017
292 nmdc:mga03n38_150680_c1
293 nmdc:mga03n38_18325_c1
294 nmdc:mga03n38_3028_c1
295 nmdc:mga00v17_61194_c1
296 nmdc:mga00v17_87010_c1
297 nmdc:mga0yw44_270987_c1
298 nmdc:mga06z11_239332_c1
299 nmdc:mga06z11_5139_c1
300 nmdc:mga06z11_56866_c1
301 nmdc:mga06z11_96016_c1
302 nmdc:mga04h51_79201_c1
303 nmdc:mga07m45_4563_c1
304 Ga0500644_0000057
305 Ga0501084_0053758
306 Ga0501084_0183861
307 Ga0501082_0032938
308 2644230244
309 2740169080
310 2774396891
311 2809198530
312 2812352890
313 2891969593
314 8054611091

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01636

APH

Phosphotransferase enzyme family

62

308

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rny-assembly3.cif.gz_B crystal structure of human rsk1 c-terminal kinase domain 0.7409 26 208
6ef6-assembly1.cif.gz_A structure of the microcompartment-associated aminopropanol kinase 0.7025 5 294
6ef6-assembly1.cif.gz_A structure of the microcompartment-associated aminopropanol kinase 0.6925 5 294
3kc3-assembly5.cif.gz_C mk2 complexed to inhibitor n4-(7-(benzofuran-2-yl)-1h-indazol-5-yl)pyrimidine-2,4-diamine 0.6871 5 208
5iqg-assembly1.cif.gz_A aminoglycoside phosphotransferase (2'')-ia (ctd of aac(6')-ie/aph(2'')-ia) in complex with gdp, magnesium, and gentamicin c1 0.6843 8 287
ID Description Score Start End Superfamily
af_A0A1D6JLB6_54_142_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.7671 6 81 3.30.200.20
af_P77739_1_92_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.7493 6 81 3.30.200.20
af_B3DMA2_17_122_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.7087 6 81 3.30.200.20
af_Q2R2M3_362_441_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.7075 14 81 3.30.200.20
af_P0AB03_41_274_3.90.1200.10 Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe 0.6729 29 262 3.90.1200.10
ID Description Score Start End GO Terms
AF-A0A4Q2SFH2-F1-model_v4 Aminoglycoside phosphotransferase family protein 0.9686 7 294 GO:0016301
AF-A0A7G9RGL4-F1-model_v4 Phosphotransferase 0.9658 6 293 GO:0016301
AF-A0A1A9GR02-F1-model_v4 Phosphotransferase enzyme family protein 0.9607 6 294 GO:0016740
AF-A0A7Y5WEK8-F1-model_v4 Phosphotransferase 0.957 88 293 GO:0016301
AF-A0A4S4ZPE3-F1-model_v4 Translation initiation factor IF-2 0.9543 6 251 GO:0003743

Map