F227831

General Info

Members Datasets Scaffolds Average Seq Length
157 41 157 269

Family's Representative Sequence

Representative Sequence 3300039093|Ga0400489_30711|Ga0400489_30711_223_1140
Length 305
Sequence LYKRLASVNRLFISAGNKEFLVILHGIFERAMKQAKVLFISQEITPYLPETEMSKIGRFLPQGIQEKGREIRTFMPKYGSINERRNQLHEVIRLSGMNLIIDDADHPLIIKVASIQSARMQVYFIDNEDYFHRKFILKDENGEYFKDNDERAIFFARGVLETVRKLRWSPDIVHCHGWISSLIPLYLKRSFADDPLYNKSKIIYSIYNDEFDKPLRKDFRKKLLMDGIKDKDVEILATPSFENLTRLALNMADAAIIGSAEINKSVQKYIKTIRKPVLEYKAEDEYINAYSDFYDEILMNKVDED

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
3 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
4 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
5 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
6 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
7 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
8 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
9 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
10 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
11 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
12 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
13 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
14 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
15 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
16 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
17 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
18 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
19 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
20 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
21 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
22 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
23 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
24 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
25 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
26 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
27 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
28 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
29 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
30 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
31 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
32 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
33 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
34 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
35 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
36 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
37 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
38 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
39 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
40 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
41 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.36
Metatranscriptomes 0.64
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.82
Rhizosphere 85.35
Stem 0
Stem Tuber 0
Unclassified 10.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10340299 3300003320 Bacteria 1054
2 Ga0070688_100033615 3300005365 Bacteria 3101
3 Ga0070678_100159026 3300005456 Unclassified 1828
4 Ga0068855_100054197 3300005563 Bacteria 4714
5 Ga0068857_100097073 3300005577 Bacteria 2642
6 Ga0068860_100086498 3300005843 Bacteria 2983
7 Ga0105242_10053893 3300009176 Bacteria 3286
8 Ga0157371_10042799 3300013102 Bacteria 3227
9 Ga0163163_10055500 3300014325 Unclassified 3915
10 Ga0163163_10107502 3300014325 Bacteria 2816
11 Ga0157380_10000003 3300014326 Bacteria 224643
12 Ga0157376_10047533 3300014969 Bacteria 3543
13 Ga0207686_10036317 3300025934 Bacteria 2966
14 Ga0207674_10117327 3300026116 Bacteria 2632
15 Ga0207683_10210649 3300026121 Unclassified 1769
16 Ga0268264_10067515 3300028381 Bacteria 3019
17 Ga0265334_10011881 3300028573 Bacteria 3658
18 Ga0265318_10034055 3300028577 Bacteria 1965
19 Ga0265323_10000379 3300028653 Bacteria 25733
20 Ga0265322_10029637 3300028654 Bacteria 1564
21 Ga0265338_10000893 3300028800 Bacteria 50100
22 Ga0265338_10003612 3300028800 Bacteria 21587
23 Ga0265327_10001528 3300031251 Bacteria 28541
24 Ga0265327_10080606 3300031251 Bacteria 1609
25 Ga0265316_10000445 3300031344 Bacteria 47073
26 Ga0265316_10002843 3300031344 Bacteria 17711
27 Ga0265316_10005814 3300031344 Bacteria 11895
28 Ga0265316_10190862 3300031344 Bacteria 1522
29 Ga0265342_10157722 3300031712 Bacteria 1256
30 Ga0316576_10033559 3300031727 Unclassified 3654
31 Ga0316576_10087607 3300031727 Unclassified 2317
32 Ga0316576_10102392 3300031727 Unclassified 2141
33 Ga0316576_10211249 3300031727 Unclassified 1460
34 Ga0316576_10273304 3300031727 Unclassified 1266
35 Ga0316578_10009507 3300031728 Bacteria 5002
36 Ga0316578_10041194 3300031728 Unclassified 2674
37 Ga0316578_10116349 3300031728 Unclassified 1606
38 Ga0316577_10154704 3300031733 Unclassified 1293
39 Ga0316580_10015279 3300032139 Unclassified 2348
40 Ga0316574_0065940 3300035398 Bacteria 2280
41 Ga0316574_0144705 3300035398 Bacteria 1532
42 Ga0316574_0265350 3300035398 Bacteria 1096
43 Ga0316582_0104724 3300036647 Bacteria 1877
44 Ga0316584_0014673 3300036712 Bacteria 5587
45 Ga0316584_0020444 3300036712 Bacteria 4800
46 Ga0316584_0026467 3300036712 Bacteria 4264
47 Ga0316584_0065042 3300036712 Bacteria 2731
48 Ga0316584_0099302 3300036712 Unclassified 2180
49 Ga0395905_0000001 3300037471 Bacteria 2037079
50 Ga0400483_006213 3300039062 Bacteria 91642
51 Ga0400483_050004 3300039062 Bacteria 1437
52 Ga0400483_101798 3300039062 Bacteria 1089
53 Ga0400489_21418 3300039093 Bacteria 1575
54 Ga0400489_30711 3300039093 Bacteria 1658
55 Ga0451795_0188283 3300041456 Unclassified 992
56 Ga0451795_0267395 3300041456 Unclassified 2246
57 Ga0451795_1042911 3300041456 Bacteria 3756
58 Ga0451795_1311191 3300041456 Bacteria 1751
59 Ga0451795_1450018 3300041456 Bacteria 910
60 Ga0451795_1514872 3300041456 Bacteria 1116
61 Ga0451855_0086382 3300041511 Bacteria 1356
62 Ga0451855_0097194 3300041511 Bacteria 1348
63 Ga0451855_0228589 3300041511 Bacteria 2819
64 Ga0451855_0302244 3300041511 Bacteria 1407
65 Ga0451855_0360278 3300041511 Unclassified 1087
66 Ga0451855_0629728 3300041511 Bacteria 1021
67 Ga0451855_0908023 3300041511 Bacteria 5854
68 Ga0451855_1009518 3300041511 Bacteria 1163
69 Ga0451855_1379178 3300041511 Bacteria 2729
70 Ga0451855_1687032 3300041511 Bacteria 3117
71 Ga0451855_1702902 3300041511 Bacteria 1278
72 Ga0451577_0000037 3300042876 Bacteria 360162
73 Ga0451577_0000043 3300042876 Bacteria 329533
74 Ga0451577_0001091 3300042876 Bacteria 38840
75 Ga0451577_0002746 3300042876 Bacteria 20402
76 Ga0451577_0011342 3300042876 Bacteria 8438
77 Ga0451577_0034910 3300042876 Bacteria 4531
78 Ga0451577_0045107 3300042876 Bacteria 3946
79 Ga0451577_0055374 3300042876 Bacteria 3539
80 Ga0451577_0073745 3300042876 Bacteria 3045
81 Ga0451577_0159654 3300042876 Bacteria 2030
82 Ga0451577_0184119 3300042876 Unclassified 1883
83 Ga0451577_0193266 3300042876 Bacteria 1836
84 Ga0451577_0346758 3300042876 Bacteria 1347
85 Ga0451577_0376046 3300042876 Bacteria 1289
86 Ga0453683_0000082 3300044673 Bacteria 143197
87 Ga0453683_0000401 3300044673 Bacteria 51183
88 Ga0453683_0000771 3300044673 Bacteria 31804
89 Ga0453683_0004554 3300044673 Bacteria 9814
90 Ga0453683_0006444 3300044673 Bacteria 8057
91 Ga0453683_0025217 3300044673 Bacteria 3778
92 Ga0453683_0092371 3300044673 Bacteria 1897
93 Ga0453683_0098400 3300044673 Bacteria 1836
94 Ga0453683_0333950 3300044673 Bacteria 972
95 Ga0453683_0336036 3300044673 Unclassified 969
96 Ga0453683_0391883 3300044673 Bacteria 895
97 Ga0453684_0000110 3300044712 Bacteria 360542
98 Ga0453684_0000133 3300044712 Bacteria 329529
99 Ga0453684_0000337 3300044712 Bacteria 195296
100 Ga0453684_0000586 3300044712 Bacteria 135374
101 Ga0453684_0001331 3300044712 Bacteria 72658
102 Ga0453684_0001471 3300044712 Bacteria 66489
103 Ga0453684_0001911 3300044712 Bacteria 53995
104 Ga0453684_0002152 3300044712 Bacteria 49337
105 Ga0453684_0004497 3300044712 Bacteria 29294
106 Ga0453684_0010068 3300044712 Bacteria 16249
107 Ga0453684_0010620 3300044712 Bacteria 15692
108 Ga0453684_0014964 3300044712 Bacteria 12330
109 Ga0453684_0016021 3300044712 Bacteria 11771
110 Ga0453684_0016892 3300044712 Bacteria 11357
111 Ga0453684_0017646 3300044712 Bacteria 11033
112 Ga0453684_0022321 3300044712 Bacteria 9398
113 Ga0453684_0028523 3300044712 Bacteria 7959
114 Ga0453684_0033633 3300044712 Bacteria 7141
115 Ga0453684_0044420 3300044712 Bacteria 5946
116 Ga0453684_0052254 3300044712 Bacteria 5346
117 Ga0453684_0059365 3300044712 Bacteria 4932
118 Ga0453684_0101308 3300044712 Bacteria 3524
119 Ga0453684_0112496 3300044712 Bacteria 3305
120 Ga0453684_0123358 3300044712 Bacteria 3123
121 Ga0453684_0125147 3300044712 Bacteria 3095
122 Ga0453684_0142534 3300044712 Bacteria 2859
123 Ga0453684_0168486 3300044712 Bacteria 2584
124 Ga0453684_0183472 3300044712 Bacteria 2454
125 Ga0453684_0255347 3300044712 Bacteria 2011
126 Ga0453684_0328641 3300044712 Bacteria 1730
127 Ga0453684_0394627 3300044712 Bacteria 1551
128 Ga0453684_0396730 3300044712 Bacteria 1546
129 Ga0453684_0407917 3300044712 Bacteria 1520
130 Ga0453684_0422252 3300044712 Bacteria 1489
131 Ga0453684_0464779 3300044712 Bacteria 1406
132 Ga0453684_0604597 3300044712 Bacteria 1201
133 Ga0453684_0611279 3300044712 Bacteria 1194
134 Ga0453684_0653054 3300044712 Bacteria 1147
135 Ga0451576_0000002 3300045051 Bacteria 1670975
136 Ga0451576_0000039 3300045051 Bacteria 360162
137 Ga0451576_0000097 3300045051 Bacteria 220569
138 Ga0451576_0000369 3300045051 Bacteria 107433
139 Ga0451576_0000371 3300045051 Bacteria 106687
140 Ga0451576_0000638 3300045051 Bacteria 72729
141 Ga0451576_0001334 3300045051 Bacteria 42651
142 Ga0451576_0004071 3300045051 Bacteria 19332
143 Ga0451576_0018376 3300045051 Bacteria 7666
144 Ga0451576_0020616 3300045051 Bacteria 7175
145 Ga0451576_0023258 3300045051 Bacteria 6712
146 Ga0451576_0028731 3300045051 Bacteria 5955
147 Ga0451576_0052239 3300045051 Bacteria 4283
148 Ga0451576_0059677 3300045051 Bacteria 3981
149 Ga0451576_0089926 3300045051 Bacteria 3193
150 Ga0451576_0166101 3300045051 Bacteria 2303
151 Ga0451576_0176713 3300045051 Bacteria 2229
152 Ga0451576_0214531 3300045051 Bacteria 2010
153 Ga0451576_0736580 3300045051 Bacteria 1035
154 Ga0451576_0789443 3300045051 Bacteria 997
155 Ga0451576_1304202 3300045051 Unclassified 757
156 Ga0501308_015677 3300049128 Bacteria 900
157 Ga0501034_0061113 3300049571 Bacteria 3784

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045051 Ga0451576_1304202 Ga0451576_1304202_124_747 207
2 3300041456 Ga0451795_1450018 Ga0451795_1450018_22_702 222
3 3300041511 Ga0451855_1702902 Ga0451855_1702902_583_1257 223
4 3300042876 Ga0451577_0073745 Ga0451577_0073745_1238_2041 239
5 3300044712 Ga0453684_0001471 Ga0453684_0001471_17656_18459 239
6 3300041511 Ga0451855_0908023 Ga0451855_0908023_5061_5810 248
7 3300028577 Ga0265318_10034055 Ga0265318_100340551 251
8 3300042876 Ga0451577_0193266 Ga0451577_0193266_979_1791 254
9 3300044712 Ga0453684_0052254 Ga0453684_0052254_116_928 254
10 3300031727 Ga0316576_10087607 Ga0316576_100876072 260
11 3300041511 Ga0451855_0360278 Ga0451855_0360278_60_857 264
12 3300044712 Ga0453684_0168486 Ga0453684_0168486_1191_2012 265
13 3300031251 Ga0265327_10080606 Ga0265327_100806062 266
14 3300041456 Ga0451795_0188283 Ga0451795_0188283_134_940 266
15 3300041456 Ga0451795_1311191 Ga0451795_1311191_366_1181 266
16 3300031344 Ga0265316_10002843 Ga0265316_1000284310 267
17 3300031344 Ga0265316_10190862 Ga0265316_101908622 267
18 3300031712 Ga0265342_10157722 Ga0265342_101577222 267
19 3300031727 Ga0316576_10211249 Ga0316576_102112492 267
20 3300035398 Ga0316574_0065940 Ga0316574_0065940_1144_1947 267
21 3300035398 Ga0316574_0144705 Ga0316574_0144705_625_1428 267
22 3300039062 Ga0400483_006213 Ga0400483_006213_60711_61514 267
23 3300039062 Ga0400483_050004 Ga0400483_050004_528_1331 267
24 3300039093 Ga0400489_21418 Ga0400489_21418_527_1330 267
25 3300041456 Ga0451795_1514872 Ga0451795_1514872_114_923 267
26 3300041511 Ga0451855_0086382 Ga0451855_0086382_71_889 267
27 3300042876 Ga0451577_0000043 Ga0451577_0000043_253396_254199 267
28 3300042876 Ga0451577_0011342 Ga0451577_0011342_3676_4479 267
29 3300042876 Ga0451577_0034910 Ga0451577_0034910_3190_3993 267
30 3300042876 Ga0451577_0045107 Ga0451577_0045107_608_1411 267
31 3300042876 Ga0451577_0055374 Ga0451577_0055374_468_1271 267
32 3300042876 Ga0451577_0159654 Ga0451577_0159654_870_1673 267
33 3300042876 Ga0451577_0346758 Ga0451577_0346758_511_1314 267
34 3300042876 Ga0451577_0376046 Ga0451577_0376046_66_869 267
35 3300044673 Ga0453683_0000401 Ga0453683_0000401_36581_37384 267
36 3300044673 Ga0453683_0000771 Ga0453683_0000771_30524_31327 267
37 3300044673 Ga0453683_0025217 Ga0453683_0025217_2525_3328 267
38 3300044673 Ga0453683_0336036 Ga0453683_0336036_137_940 267
39 3300044673 Ga0453683_0391883 Ga0453683_0391883_35_844 267
40 3300044712 Ga0453684_0000133 Ga0453684_0000133_253392_254195 267
41 3300044712 Ga0453684_0000586 Ga0453684_0000586_98400_99203 267
42 3300044712 Ga0453684_0010620 Ga0453684_0010620_6920_7723 267
43 3300044712 Ga0453684_0016892 Ga0453684_0016892_2619_3422 267
44 3300044712 Ga0453684_0017646 Ga0453684_0017646_981_1784 267
45 3300044712 Ga0453684_0022321 Ga0453684_0022321_7317_8120 267
46 3300044712 Ga0453684_0044420 Ga0453684_0044420_3532_4335 267
47 3300044712 Ga0453684_0059365 Ga0453684_0059365_962_1765 267
48 3300044712 Ga0453684_0125147 Ga0453684_0125147_666_1469 267
49 3300044712 Ga0453684_0142534 Ga0453684_0142534_695_1498 267
50 3300044712 Ga0453684_0422252 Ga0453684_0422252_500_1303 267
51 3300045051 Ga0451576_0000097 Ga0451576_0000097_144433_145236 267
52 3300045051 Ga0451576_0052239 Ga0451576_0052239_2634_3437 267
53 3300045051 Ga0451576_0059677 Ga0451576_0059677_2936_3739 267
54 3300045051 Ga0451576_0089926 Ga0451576_0089926_561_1364 267
55 3300045051 Ga0451576_0166101 Ga0451576_0166101_279_1082 267
56 3300045051 Ga0451576_0176713 Ga0451576_0176713_146_949 267
57 3300041511 Ga0451855_0097194 Ga0451855_0097194_115_936 268
58 3300042876 Ga0451577_0184119 Ga0451577_0184119_478_1284 268
59 3300044673 Ga0453683_0004554 Ga0453683_0004554_46_852 268
60 3300044673 Ga0453683_0006444 Ga0453683_0006444_4656_5462 268
61 3300044673 Ga0453683_0092371 Ga0453683_0092371_41_847 268
62 3300044673 Ga0453683_0098400 Ga0453683_0098400_982_1791 268
63 3300044712 Ga0453684_0000337 Ga0453684_0000337_76634_77440 268
64 3300044712 Ga0453684_0014964 Ga0453684_0014964_7878_8684 268
65 3300044712 Ga0453684_0016021 Ga0453684_0016021_5804_6610 268
66 3300044712 Ga0453684_0101308 Ga0453684_0101308_1056_1862 268
67 3300044712 Ga0453684_0255347 Ga0453684_0255347_56_862 268
68 3300044712 Ga0453684_0394627 Ga0453684_0394627_273_1082 268
69 3300044712 Ga0453684_0604597 Ga0453684_0604597_299_1105 268
70 3300044712 Ga0453684_0611279 Ga0453684_0611279_108_914 268
71 3300045051 Ga0451576_0000369 Ga0451576_0000369_95284_96090 268
72 3300045051 Ga0451576_0001334 Ga0451576_0001334_30485_31291 268
73 3300045051 Ga0451576_0018376 Ga0451576_0018376_2252_3058 268
74 3300045051 Ga0451576_0023258 Ga0451576_0023258_1311_2117 268
75 3300045051 Ga0451576_0736580 Ga0451576_0736580_72_878 268
76 3300028800 Ga0265338_10000893 Ga0265338_1000089319 269
77 3300028800 Ga0265338_10003612 Ga0265338_100036126 269
78 3300031727 Ga0316576_10102392 Ga0316576_101023922 269
79 3300031727 Ga0316576_10273304 Ga0316576_102733042 269
80 3300031728 Ga0316578_10009507 Ga0316578_100095075 269
81 3300036712 Ga0316584_0099302 Ga0316584_0099302_843_1652 269
82 3300041511 Ga0451855_0228589 Ga0451855_0228589_52_864 269
83 3300041511 Ga0451855_0629728 Ga0451855_0629728_145_957 269
84 3300041511 Ga0451855_1687032 Ga0451855_1687032_2007_2831 269
85 3300044712 Ga0453684_0002152 Ga0453684_0002152_26952_27761 269
86 3300044712 Ga0453684_0004497 Ga0453684_0004497_2570_3379 269
87 3300044712 Ga0453684_0028523 Ga0453684_0028523_4365_5174 269
88 3300044712 Ga0453684_0033633 Ga0453684_0033633_4016_4825 269
89 3300044712 Ga0453684_0112496 Ga0453684_0112496_300_1133 269
90 3300044712 Ga0453684_0328641 Ga0453684_0328641_850_1662 269
91 3300045051 Ga0451576_0028731 Ga0451576_0028731_892_1701 269
92 3300045051 Ga0451576_0214531 Ga0451576_0214531_1129_1938 269
93 3300045051 Ga0451576_0789443 Ga0451576_0789443_14_823 269
94 3300028653 Ga0265323_10000379 Ga0265323_100003795 270
95 3300031251 Ga0265327_10001528 Ga0265327_1000152811 270
96 3300031344 Ga0265316_10000445 Ga0265316_1000044512 270
97 3300031344 Ga0265316_10005814 Ga0265316_100058149 270
98 3300031728 Ga0316578_10116349 Ga0316578_101163492 270
99 3300031733 Ga0316577_10154704 Ga0316577_101547042 270
100 3300032139 Ga0316580_10015279 Ga0316580_100152792 270
101 3300035398 Ga0316574_0265350 Ga0316574_0265350_132_944 270
102 3300036647 Ga0316582_0104724 Ga0316582_0104724_189_1001 270
103 3300036712 Ga0316584_0014673 Ga0316584_0014673_3848_4660 270
104 3300036712 Ga0316584_0065042 Ga0316584_0065042_1007_1819 270
105 3300041456 Ga0451795_0267395 Ga0451795_0267395_511_1332 270
106 3300041511 Ga0451855_0302244 Ga0451855_0302244_557_1372 270
107 3300041511 Ga0451855_1009518 Ga0451855_1009518_58_954 270
108 3300042876 Ga0451577_0002746 Ga0451577_0002746_19528_20340 270
109 3300044712 Ga0453684_0001331 Ga0453684_0001331_6647_7459 270
110 3300045051 Ga0451576_0000371 Ga0451576_0000371_61829_62641 270
111 3300045051 Ga0451576_0000638 Ga0451576_0000638_65271_66083 270
112 3300041511 Ga0451855_1379178 Ga0451855_1379178_289_1122 271
113 3300042876 Ga0451577_0000037 Ga0451577_0000037_151404_152219 271
114 3300044673 Ga0453683_0000082 Ga0453683_0000082_68379_69194 271
115 3300044712 Ga0453684_0000110 Ga0453684_0000110_151784_152599 271
116 3300045051 Ga0451576_0000039 Ga0451576_0000039_207944_208759 271
117 3300041456 Ga0451795_1042911 Ga0451795_1042911_1455_2282 272
118 3300044673 Ga0453683_0333950 Ga0453683_0333950_15_839 272
119 3300044712 Ga0453684_0001911 Ga0453684_0001911_18381_19199 272
120 3300044712 Ga0453684_0010068 Ga0453684_0010068_8481_9299 272
121 3300044712 Ga0453684_0183472 Ga0453684_0183472_670_1488 272
122 3300044712 Ga0453684_0407917 Ga0453684_0407917_48_866 272
123 3300044712 Ga0453684_0464779 Ga0453684_0464779_403_1221 272
124 3300045051 Ga0451576_0020616 Ga0451576_0020616_939_1757 272
125 3300028654 Ga0265322_10029637 Ga0265322_100296371 273
126 3300031727 Ga0316576_10033559 Ga0316576_100335593 273
127 3300036712 Ga0316584_0020444 Ga0316584_0020444_1953_2777 273
128 3300039062 Ga0400483_101798 Ga0400483_101798_228_1049 273
129 3300049571 Ga0501034_0061113 Ga0501034_0061113_790_1614 273
130 3300044712 Ga0453684_0123358 Ga0453684_0123358_396_1220 274
131 3300044712 Ga0453684_0396730 Ga0453684_0396730_332_1156 274
132 3300044712 Ga0453684_0653054 Ga0453684_0653054_122_949 274
133 3300045051 Ga0451576_0004071 Ga0451576_0004071_2593_3420 274
134 3300005365 Ga0070688_100033615 Ga0070688_1000336152 275
135 3300005456 Ga0070678_100159026 Ga0070678_1001590262 275
136 3300005843 Ga0068860_100086498 Ga0068860_1000864983 275
137 3300009176 Ga0105242_10053893 Ga0105242_100538933 275
138 3300014325 Ga0163163_10055500 Ga0163163_100555003 275
139 3300014325 Ga0163163_10107502 Ga0163163_101075023 275
140 3300014326 Ga0157380_10000003 Ga0157380_10000003112 275
141 3300014969 Ga0157376_10047533 Ga0157376_100475332 275
142 3300025934 Ga0207686_10036317 Ga0207686_100363173 275
143 3300026121 Ga0207683_10210649 Ga0207683_102106491 275
144 3300028381 Ga0268264_10067515 Ga0268264_100675153 275
145 3300028573 Ga0265334_10011881 Ga0265334_100118813 275
146 3300031728 Ga0316578_10041194 Ga0316578_100411944 275
147 3300036712 Ga0316584_0026467 Ga0316584_0026467_890_1717 275
148 3300039093 Ga0400489_30711 Ga0400489_30711_223_1140 275
149 3300045051 Ga0451576_0000002 Ga0451576_0000002_323629_324456 275
150 3300049128 Ga0501308_015677 Ga0501308_015677_45_875 275
151 3300003320 rootH2_10340299 rootH2_103402992 276
152 3300005563 Ga0068855_100054197 Ga0068855_1000541972 276
153 3300005577 Ga0068857_100097073 Ga0068857_1000970732 276
154 3300013102 Ga0157371_10042799 Ga0157371_100427992 276
155 3300026116 Ga0207674_10117327 Ga0207674_101173273 276
156 3300037471 Ga0395905_0000001 Ga0395905_0000001_1235426_1236256 276
157 3300042876 Ga0451577_0001091 Ga0451577_0001091_27603_28433 276

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08323

Glyco_transf_5

Starch synthase catalytic domain

36

282

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cx4-assembly1.cif.gz_A crystal structure of e.coli gs mutant e377a in complex with adp and oligosaccharides 0.7989 6 229
1rzu-assembly1.cif.gz_A crystal structure of the glycogen synthase from a. tumefaciens in complex with adp 0.7826 6 250
6gne-assembly1.cif.gz_A catalytic domain of starch synthase iv from arabidopsis thaliana bound to adp and acarbose 0.7792 2 250
3l01-assembly2.cif.gz_B crystal structure of monomeric glycogen synthase from pyrococcus abyssi 0.7637 5 249
6gnf-assembly3.cif.gz_C granule bound starch synthase from cyanobacterium sp. clg1 bound to acarbose and adp 0.7454 1 254
ID Description Score Start End Superfamily
af_K7TNQ6_745_904_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8729 8 176 3.40.50.2000
af_K7TNQ6_745_904_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8373 8 176 3.40.50.2000
3l01A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7928 4 264 3.40.50.2000
af_Q9FNF2_138_413_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7927 4 252 3.40.50.2000
af_K7L5I8_494_746_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7815 8 250 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A2R7KIM9-F1-model_v4 starch synthase (EC 2.4.1.21) 0.9793 4 225 GO:0016757
AF-R5BDN5-F1-model_v4 starch synthase (EC 2.4.1.21) 0.9786 4 266 GO:0016757
AF-U6RS03-F1-model_v4 starch synthase (EC 2.4.1.21) 0.9784 4 270 GO:0016020
GO:0016757
AF-A0A2E7H6A0-F1-model_v4 starch synthase (EC 2.4.1.21) 0.977 3 270 GO:0016757
AF-F3PSH7-F1-model_v4 starch synthase (EC 2.4.1.21) 0.9757 2 272 GO:0016757

Feature Viewer

pLDDT pTM Quality
89.94 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map