F227646

General Info

Members Datasets Scaffolds Average Seq Length
157 99 314 246

Family's Representative Sequence

Representative Sequence 3300031711|Ga0265314_10026510|Ga0265314_100265104
Length 274
Sequence MNEPENSNPAQPVASAGSSLPPVIPHVSEIWHRPGEEPLGTDSVERTAVPGVIGAVEAMLRQPRRVMYQLRQPGSAGLSGSLVLVAVLCSLVYGVVVGTFSGGEQLWAAPAKIVLGMAISALICLPSLYIFSCLSGSSANIKEVFGLVTGLLALMTVLLVGFAPVAWVFSQSTKSLVAMGGLHLVFWLVAVAFGIRFLSSGFRNYSARSPGGIRVWVVIFLLVVLQMTTALRPIVGKSDRFLPAAEEKQFFVTHWLNCIDAESETNRGDRARND

Samples

Sample ID Description Type Environment
1 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
41 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
42 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
60 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
61 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
62 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
63 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
64 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
65 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
66 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
67 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
68 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
69 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
70 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
71 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
72 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
73 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
74 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
75 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
76 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
77 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
78 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
79 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
80 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
81 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
82 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
83 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
84 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
85 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
86 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
87 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
88 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
89 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
90 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
91 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
92 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
93 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
94 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
95 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
96 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
97 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
98 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
99 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.64
Rhizosphere 97.45
Stem 0
Stem Tuber 0
Unclassified 32.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265314_10026510 3300031711 Bacteria 4354
2 rootH2_10043308 3300003320 Bacteria 23842
3 rootH1_10157196 3300003323 Bacteria 4516
4 Ga0070690_100040652 3300005330 Unclassified 2942
5 Ga0070670_100432299 3300005331 Bacteria 1165
6 Ga0070680_100091461 3300005336 Unclassified 2519
7 Ga0070689_100001261 3300005340 Bacteria 16093
8 Ga0070689_100003608 3300005340 Bacteria 10318
9 Ga0070689_100006797 3300005340 Bacteria 7955
10 Ga0070689_100069522 3300005340 Unclassified 2747
11 Ga0070689_100492588 3300005340 Unclassified 1049
12 Ga0070675_100234647 3300005354 Bacteria 1601
13 Ga0070688_100021606 3300005365 Unclassified 3761
14 Ga0070688_100059422 3300005365 Unclassified 2411
15 Ga0070701_10024980 3300005438 Bacteria 2896
16 Ga0070711_100012166 3300005439 Bacteria 5371
17 Ga0070711_100469031 3300005439 Unclassified 1033
18 Ga0070711_100706987 3300005439 Bacteria 849
19 Ga0070705_100032113 3300005440 Bacteria 2914
20 Ga0070700_100137765 3300005441 Bacteria 1655
21 Ga0070694_100063631 3300005444 Bacteria 2523
22 Ga0070708_100188580 3300005445 Bacteria 1929
23 Ga0070681_10030405 3300005458 Unclassified 5419
24 Ga0070681_10038935 3300005458 Unclassified 4766
25 Ga0070685_10088578 3300005466 Bacteria 1869
26 Ga0070707_100355969 3300005468 Bacteria 1422
27 Ga0070697_100496212 3300005536 Unclassified 1067
28 Ga0070686_100001138 3300005544 Bacteria 15272
29 Ga0070686_100026919 3300005544 Unclassified 3475
30 Ga0070686_100354506 3300005544 Bacteria 1103
31 Ga0070704_100024936 3300005549 Unclassified 3930
32 Ga0068855_100059912 3300005563 Bacteria 4453
33 Ga0068855_100114054 3300005563 Unclassified 3099
34 Ga0068855_100191901 3300005563 Unclassified 2304
35 Ga0068857_100011540 3300005577 Bacteria 7687
36 Ga0068856_100036051 3300005614 Bacteria 4850
37 Ga0068856_100160016 3300005614 Unclassified 2262
38 Ga0068856_100201197 3300005614 Unclassified 2006
39 Ga0068859_100085643 3300005617 Unclassified 3197
40 Ga0068859_100098444 3300005617 Unclassified 2979
41 Ga0068859_100262848 3300005617 Bacteria 1817
42 Ga0068863_100007510 3300005841 Bacteria 10662
43 Ga0068863_100042737 3300005841 Unclassified 4306
44 Ga0081455_10085807 3300005937 Bacteria 2565
45 Ga0070712_100053466 3300006175 Bacteria 2819
46 Ga0075431_100047409 3300006847 Unclassified 4430
47 Ga0075429_100117702 3300006880 Unclassified 2322
48 Ga0097620_100085644 3300006931 Unclassified 3197
49 Ga0097620_100098441 3300006931 Unclassified 2979
50 Ga0097620_100262835 3300006931 Bacteria 1817
51 Ga0105240_10051900 3300009093 Bacteria 5157
52 Ga0105240_10367930 3300009093 Unclassified 1626
53 Ga0105240_10532806 3300009093 Unclassified 1302
54 Ga0111539_10044191 3300009094 Bacteria 5338
55 Ga0111539_10137482 3300009094 Bacteria 2861
56 Ga0111539_10199560 3300009094 Bacteria 2333
57 Ga0105241_10100829 3300009174 Unclassified 2295
58 Ga0105237_10354382 3300009545 Unclassified 1472
59 Ga0105238_10017171 3300009551 Bacteria 7349
60 Ga0105238_10025680 3300009551 Bacteria 6006
61 Ga0105249_10260069 3300009553 Bacteria 1724
62 Ga0157375_10000058 3300013308 Bacteria 121019
63 Ga0157375_10042780 3300013308 Bacteria 4387
64 Ga0163163_10098244 3300014325 Bacteria 2949
65 Ga0157379_10666863 3300014968 Bacteria 975
66 Ga0157376_10469807 3300014969 Bacteria 1230
67 Ga0157376_10869667 3300014969 Unclassified 918
68 Ga0207684_10458532 3300025910 Bacteria 1094
69 Ga0207707_10057896 3300025912 Bacteria 3373
70 Ga0207707_10127378 3300025912 Bacteria 2227
71 Ga0207695_10314091 3300025913 Unclassified 1457
72 Ga0207695_10366787 3300025913 Unclassified 1326
73 Ga0207695_10527432 3300025913 Bacteria 1062
74 Ga0207660_10052852 3300025917 Unclassified 2893
75 Ga0207652_10068443 3300025921 Unclassified 3081
76 Ga0207694_10003771 3300025924 Bacteria 12004
77 Ga0207694_10009450 3300025924 Bacteria 7349
78 Ga0207659_10311758 3300025926 Bacteria 1296
79 Ga0207700_10308438 3300025928 Unclassified 1368
80 Ga0207664_10000746 3300025929 Bacteria 22125
81 Ga0207670_10000576 3300025936 Bacteria 20270
82 Ga0207670_10001901 3300025936 Bacteria 10915
83 Ga0207667_10072097 3300025949 Bacteria 3590
84 Ga0207667_10116943 3300025949 Bacteria 2748
85 Ga0207703_10412801 3300026035 Bacteria 1255
86 Ga0207708_10150245 3300026075 Bacteria 1833
87 Ga0207708_10246408 3300026075 Unclassified 1439
88 Ga0207702_10001688 3300026078 Bacteria 21811
89 Ga0207702_10105096 3300026078 Unclassified 2500
90 Ga0207641_10012641 3300026088 Bacteria 6923
91 Ga0207641_10016874 3300026088 Bacteria 5979
92 Ga0207641_10204535 3300026088 Bacteria 1823
93 Ga0207676_10519948 3300026095 Unclassified 1133
94 Ga0207674_10017893 3300026116 Bacteria 7724
95 Ga0265326_10000722 3300028558 Bacteria 12193
96 Ga0265319_1002255 3300028563 Bacteria 10685
97 Ga0265323_10071121 3300028653 Unclassified 1189
98 Ga0265338_10000160 3300028800 Bacteria 122713
99 Ga0265338_10000310 3300028800 Bacteria 88170
100 Ga0265338_10056229 3300028800 Unclassified 3492
101 Ga0265338_10112265 3300028800 Bacteria 2192
102 Ga0265338_10473812 3300028800 Bacteria 884
103 Ga0265324_10000403 3300029957 Bacteria 31109
104 Ga0265324_10005941 3300029957 Bacteria 5175
105 Ga0265324_10008850 3300029957 Bacteria 3968
106 Ga0265327_10000600 3300031251 Bacteria 59726
107 Ga0265316_10009551 3300031344 Bacteria 8919
108 Ga0307508_10000574 3300031616 Bacteria 43711
109 Ga0265314_10007829 3300031711 Bacteria 9232
110 Ga0307411_10450150 3300032005 Bacteria 1077
111 Ga0373926_0076762 3300035083 Bacteria 1232
112 Ga0373944_0104352 3300035089 Bacteria 961
113 Ga0373945_0059004 3300035116 Bacteria 1428
114 Ga0373935_0065793 3300035692 Bacteria 2327
115 Ga0373927_0008931 3300035695 Bacteria 6729
116 Ga0373925_0001575 3300037068 Bacteria 19287
117 Ga0373925_0225358 3300037068 Bacteria 1497
118 Ga0451577_0008776 3300042876 Bacteria 9798
119 Ga0451577_0027290 3300042876 Bacteria 5167
120 Ga0451577_0036520 3300042876 Bacteria 4423
121 Ga0451576_0043680 3300045051 Bacteria 4728
122 Ga0451576_0196643 3300045051 Unclassified 2106
123 Ga0451576_0299876 3300045051 Bacteria 1681
124 Ga0495592_0000087 3300046454 Bacteria 81851
125 Ga0495641_0047731 3300046461 Bacteria 1965
126 Ga0495662_0018618 3300046476 Unclassified 3361
127 Ga0495618_0001019 3300046514 Bacteria 19204
128 Ga0495628_0000056 3300046516 Bacteria 89432
129 Ga0495630_0000065 3300046517 Bacteria 85152
130 Ga0495630_0003431 3300046517 Bacteria 11027
131 Ga0495630_0080941 3300046517 Bacteria 2451
132 Ga0495666_0018169 3300046526 Unclassified 3502
133 Ga0495666_0023220 3300046526 Unclassified 3067
134 Ga0495652_0272155 3300046529 Bacteria 1244
135 Ga0495665_0207763 3300046531 Unclassified 1014
136 Ga0495665_0307971 3300046531 Bacteria 810
137 Ga0495640_0004603 3300046533 Bacteria 11001
138 Ga0495586_0000012 3300046535 Bacteria 138093
139 Ga0495586_0003122 3300046535 Bacteria 8914
140 Ga0495645_0095036 3300046543 Unclassified 2125
141 Ga0495634_0090123 3300046642 Bacteria 1993
142 Ga0495599_0052860 3300046678 Unclassified 2545
143 Ga0495647_0067372 3300046681 Bacteria 1426
144 Ga0495658_0011407 3300046683 Bacteria 4469
145 Ga0495669_0112374 3300046684 Bacteria 1273
146 Ga0495674_0000385 3300047319 Bacteria 39496
147 Ga0495674_0010420 3300047319 Bacteria 8801
148 Ga0495674_0556678 3300047319 Bacteria 912
149 Ga0495676_0010927 3300047321 Bacteria 8206
150 Ga0495676_0042337 3300047321 Bacteria 3740
151 Ga0496115_0031183 3300048918 Bacteria 4198
152 Ga0501047_0082467 3300049581 Unclassified 3091
153 nmdc:mga09592_113541_c1 3300050508 Unclassified 2325
154 nmdc:mga06r32_32149_c1 3300050510 Unclassified 4933
155 nmdc:mga08y16_131398_c1 3300050511 Unclassified 2603
156 nmdc:mga08y16_381236_c1 3300050511 Unclassified 1445
157 nmdc:mga08y16_81594_c1 3300050511 Unclassified 3371
158 Ga0265314_10026510
159 rootH2_10043308
160 rootH1_10157196
161 Ga0070690_100040652
162 Ga0070670_100432299
163 Ga0070680_100091461
164 Ga0070689_100001261
165 Ga0070689_100003608
166 Ga0070689_100006797
167 Ga0070689_100069522
168 Ga0070689_100492588
169 Ga0070675_100234647
170 Ga0070688_100021606
171 Ga0070688_100059422
172 Ga0070701_10024980
173 Ga0070711_100012166
174 Ga0070711_100469031
175 Ga0070711_100706987
176 Ga0070705_100032113
177 Ga0070700_100137765
178 Ga0070694_100063631
179 Ga0070708_100188580
180 Ga0070681_10030405
181 Ga0070681_10038935
182 Ga0070685_10088578
183 Ga0070707_100355969
184 Ga0070697_100496212
185 Ga0070686_100001138
186 Ga0070686_100026919
187 Ga0070686_100354506
188 Ga0070704_100024936
189 Ga0068855_100059912
190 Ga0068855_100114054
191 Ga0068855_100191901
192 Ga0068857_100011540
193 Ga0068856_100036051
194 Ga0068856_100160016
195 Ga0068856_100201197
196 Ga0068859_100085643
197 Ga0068859_100098444
198 Ga0068859_100262848
199 Ga0068863_100007510
200 Ga0068863_100042737
201 Ga0081455_10085807
202 Ga0070712_100053466
203 Ga0075431_100047409
204 Ga0075429_100117702
205 Ga0097620_100085644
206 Ga0097620_100098441
207 Ga0097620_100262835
208 Ga0105240_10051900
209 Ga0105240_10367930
210 Ga0105240_10532806
211 Ga0111539_10044191
212 Ga0111539_10137482
213 Ga0111539_10199560
214 Ga0105241_10100829
215 Ga0105237_10354382
216 Ga0105238_10017171
217 Ga0105238_10025680
218 Ga0105249_10260069
219 Ga0157375_10000058
220 Ga0157375_10042780
221 Ga0163163_10098244
222 Ga0157379_10666863
223 Ga0157376_10469807
224 Ga0157376_10869667
225 Ga0207684_10458532
226 Ga0207707_10057896
227 Ga0207707_10127378
228 Ga0207695_10314091
229 Ga0207695_10366787
230 Ga0207695_10527432
231 Ga0207660_10052852
232 Ga0207652_10068443
233 Ga0207694_10003771
234 Ga0207694_10009450
235 Ga0207659_10311758
236 Ga0207700_10308438
237 Ga0207664_10000746
238 Ga0207670_10000576
239 Ga0207670_10001901
240 Ga0207667_10072097
241 Ga0207667_10116943
242 Ga0207703_10412801
243 Ga0207708_10150245
244 Ga0207708_10246408
245 Ga0207702_10001688
246 Ga0207702_10105096
247 Ga0207641_10012641
248 Ga0207641_10016874
249 Ga0207641_10204535
250 Ga0207676_10519948
251 Ga0207674_10017893
252 Ga0265326_10000722
253 Ga0265319_1002255
254 Ga0265323_10071121
255 Ga0265338_10000160
256 Ga0265338_10000310
257 Ga0265338_10056229
258 Ga0265338_10112265
259 Ga0265338_10473812
260 Ga0265324_10000403
261 Ga0265324_10005941
262 Ga0265324_10008850
263 Ga0265327_10000600
264 Ga0265316_10009551
265 Ga0307508_10000574
266 Ga0265314_10007829
267 Ga0307411_10450150
268 Ga0373926_0076762
269 Ga0373944_0104352
270 Ga0373945_0059004
271 Ga0373935_0065793
272 Ga0373927_0008931
273 Ga0373925_0001575
274 Ga0373925_0225358
275 Ga0451577_0008776
276 Ga0451577_0027290
277 Ga0451577_0036520
278 Ga0451576_0043680
279 Ga0451576_0196643
280 Ga0451576_0299876
281 Ga0495592_0000087
282 Ga0495641_0047731
283 Ga0495662_0018618
284 Ga0495618_0001019
285 Ga0495628_0000056
286 Ga0495630_0000065
287 Ga0495630_0003431
288 Ga0495630_0080941
289 Ga0495666_0018169
290 Ga0495666_0023220
291 Ga0495652_0272155
292 Ga0495665_0207763
293 Ga0495665_0307971
294 Ga0495640_0004603
295 Ga0495586_0000012
296 Ga0495586_0003122
297 Ga0495645_0095036
298 Ga0495634_0090123
299 Ga0495599_0052860
300 Ga0495647_0067372
301 Ga0495658_0011407
302 Ga0495669_0112374
303 Ga0495674_0000385
304 Ga0495674_0010420
305 Ga0495674_0556678
306 Ga0495676_0010927
307 Ga0495676_0042337
308 Ga0496115_0031183
309 Ga0501047_0082467
310 nmdc:mga09592_113541_c1
311 nmdc:mga06r32_32149_c1
312 nmdc:mga08y16_131398_c1
313 nmdc:mga08y16_381236_c1
314 nmdc:mga08y16_81594_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7d3s-assembly1.cif.gz_R human secr in complex with an engineered gs heterotrimer 0.3274 22 203
7u8o-assembly1.cif.gz_b structure of porcine v-atpase with meak7 and sidk, rotary state 2 0.3244 51 212
7vvl-assembly1.cif.gz_R pth-bound human pth1r in complex with gs (class2) 0.3243 38 204
4uos-assembly1.cif.gz_A thermodynamic hyperstability in parametrically designed helical bundles 0.3178 30 203
8d9p-assembly1.cif.gz_A de novo photosynthetic reaction center protein equipped with heme b and mn(ii) cations 0.3076 48 203
ID Description Score Start End Superfamily
af_Q58957_173_376_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.4794 51 200 1.20.1640.10
af_P9WJU1_134_330_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.4667 28 207 1.20.1640.10
af_P9WGP1_361_542_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.4573 48 204 1.20.1640.10
af_P9WJU7_74_391_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.4357 56 200 1.20.1640.10
af_G5EE13_267_487_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.434 28 206 1.20.1640.10
ID Description Score Start End GO Terms
AF-A0A1G0YIE9-F1-model_v4 Yip1 domain-containing protein 0.9577 27 229 GO:0016020
AF-A0A2V5W3J6-F1-model_v4 Uncharacterized protein 0.948 29 231 GO:0016020
AF-A0A2E7YWG6-F1-model_v4 deleted 0.9445 28 232
AF-A0A3D1K0W6-F1-model_v4 Yip1 domain-containing protein 0.9353 20 231 GO:0016020
AF-A0A2V6BZ36-F1-model_v4 Uncharacterized protein 0.934 52 236 GO:0016020

Map