F226857

General Info

Members Datasets Scaffolds Average Seq Length
157 116 157 271

Family's Representative Sequence

Representative Sequence 3300005719|Ga0068861_100398299|Ga0068861_1003982992
Length 293
Sequence VRDSGMARPGPVVKLLVMVLAALWACGGTSALASMGGAPAGALTLLGAETTPRKSFYFGFRFPRLSYTIASSQPQNDLRIDVVDTLGEVVKTFYRNDVAPDVANSIRWDGSTNEGKPARNGRYSFRIGPQTSEAPAARKATQSTALVLSFSFYGYAFPILGNHEFGLSAGRFGAGRSGHTHQGQDTMAACGTPLVAARGGTVQYAGYQGAAGNYLVIDGKGTTYDFMYAHLAEPTPLQAGETVRTGQPIGLVGDTGDASGCHLHFEMWGAPGWYEGGSPIDPLPYLEKWDAYS

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
15 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
16 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
17 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
20 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
21 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
22 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
23 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
24 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
25 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
26 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
27 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
28 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
29 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
30 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
31 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
32 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
53 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
54 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
55 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
56 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
57 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
58 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
59 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
60 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
61 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
62 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
63 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
64 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
65 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
66 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
67 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
68 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
69 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
70 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
71 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
72 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
73 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
74 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
75 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
76 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
77 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
78 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
79 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
80 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
81 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
82 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
83 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
84 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
85 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
86 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
87 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
88 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
89 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
90 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
91 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
92 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
93 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
94 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
95 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
96 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
97 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
98 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
99 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
100 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
101 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
102 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
103 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
104 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
105 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
106 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
107 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
108 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
111 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
112 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
113 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
114 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
115 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
116 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.64
Nodule 0
Rhizoplane 17.83
Rhizosphere 80.25
Stem 0
Stem Tuber 0
Unclassified 1.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100246725 3300005331 Bacteria 1555
2 Ga0070677_10000028 3300005333 Bacteria 43011
3 Ga0070682_100000026 3300005337 Bacteria 191388
4 Ga0070660_100104423 3300005339 Bacteria 2248
5 Ga0070689_100234679 3300005340 Bacteria 1509
6 Ga0070668_100003464 3300005347 Bacteria 11647
7 Ga0070688_100059651 3300005365 Bacteria 2407
8 Ga0070659_100021131 3300005366 Bacteria 4952
9 Ga0070667_100002169 3300005367 Bacteria 17281
10 Ga0070679_100000088 3300005530 Bacteria 69314
11 Ga0068853_100022430 3300005539 Bacteria 5273
12 Ga0070665_100000022 3300005548 Bacteria 379286
13 Ga0070665_100098183 3300005548 Bacteria 2933
14 Ga0068856_100000417 3300005614 Bacteria 46946
15 Ga0068856_100009644 3300005614 Bacteria 9373
16 Ga0068861_100398299 3300005719 Bacteria 1221
17 Ga0068863_100025204 3300005841 Bacteria 5670
18 Ga0068858_100001140 3300005842 Bacteria 27503
19 Ga0068862_100004251 3300005844 Bacteria 12129
20 Ga0081455_10023071 3300005937 Bacteria 5797
21 Ga0068865_100000499 3300006881 Bacteria 22000
22 Ga0105245_10000040 3300009098 Bacteria 144005
23 Ga0105245_10000857 3300009098 Bacteria 27591
24 Ga0105245_10109322 3300009098 Bacteria 2569
25 Ga0105247_10000131 3300009101 Bacteria 72578
26 Ga0105241_10027720 3300009174 Bacteria 4218
27 Ga0105242_10000063 3300009176 Bacteria 74721
28 Ga0105242_10000378 3300009176 Bacteria 35439
29 Ga0105242_10086502 3300009176 Bacteria 2631
30 Ga0105249_10000218 3300009553 Bacteria 65480
31 Ga0105249_10002088 3300009553 Bacteria 17318
32 Ga0105249_10122516 3300009553 Bacteria 2473
33 Ga0157371_10015967 3300013102 Bacteria 5616
34 Ga0157374_10011592 3300013296 Bacteria 7643
35 Ga0157378_10036953 3300013297 Bacteria 4324
36 Ga0157372_10001749 3300013307 Bacteria 23545
37 Ga0157375_10003400 3300013308 Bacteria 13793
38 Ga0157375_10028367 3300013308 Bacteria 5246
39 Ga0157380_10000007 3300014326 Bacteria 157634
40 Ga0157380_10003730 3300014326 Bacteria 10481
41 Ga0157379_10018776 3300014968 Bacteria 6096
42 Ga0157379_10036169 3300014968 Bacteria 4403
43 Ga0207682_10000041 3300025893 Bacteria 52338
44 Ga0207710_10000384 3300025900 Bacteria 30192
45 Ga0207657_10143992 3300025919 Bacteria 1945
46 Ga0207652_10000232 3300025921 Bacteria 58473
47 Ga0207694_10000012 3300025924 Bacteria 411218
48 Ga0207687_10000095 3300025927 Bacteria 64664
49 Ga0207687_10000128 3300025927 Bacteria 50603
50 Ga0207687_10002108 3300025927 Bacteria 13594
51 Ga0207686_10000230 3300025934 Bacteria 42566
52 Ga0207686_10000517 3300025934 Bacteria 24947
53 Ga0207670_10163186 3300025936 Bacteria 1665
54 Ga0207670_10195874 3300025936 Bacteria 1532
55 Ga0207704_10000018 3300025938 Bacteria 153994
56 Ga0207712_10000027 3300025961 Bacteria 263739
57 Ga0207712_10002074 3300025961 Bacteria 13155
58 Ga0207712_10109101 3300025961 Bacteria 2072
59 Ga0207668_10001430 3300025972 Bacteria 14063
60 Ga0207703_10000020 3300026035 Bacteria 251603
61 Ga0207639_10025990 3300026041 Bacteria 4251
62 Ga0207708_10031650 3300026075 Bacteria 4016
63 Ga0207702_10000105 3300026078 Bacteria 97835
64 Ga0207702_10004970 3300026078 Bacteria 11682
65 Ga0207641_10147079 3300026088 Bacteria 2131
66 Ga0207675_100397119 3300026118 Bacteria 1358
67 Ga0207683_10014653 3300026121 Bacteria 6678
68 Ga0268266_10000029 3300028379 Bacteria 424015
69 Ga0268265_10021075 3300028380 Bacteria 4559
70 Ga0265337_1000167 3300028556 Bacteria 34055
71 Ga0265326_10000179 3300028558 Bacteria 32210
72 Ga0265322_10000005 3300028654 Bacteria 246112
73 Ga0265324_10000183 3300029957 Bacteria 48185
74 Ga0265332_10036070 3300031238 Unclassified 2147
75 Ga0265328_10017085 3300031239 Bacteria 2813
76 Ga0265320_10000010 3300031240 Bacteria 250501
77 Ga0265331_10000217 3300031250 Bacteria 69142
78 Ga0265327_10000040 3300031251 Bacteria 291052
79 Ga0265316_10031209 3300031344 Bacteria 4360
80 Ga0265314_10000578 3300031711 Bacteria 46350
81 Ga0373937_0066223 3300036401 Bacteria 3326
82 Ga0451807_2119411 3300041486 Unclassified 1794
83 Ga0451853_0076491 3300041512 Bacteria 6230
84 Ga0466963_0000141 3300044694 Bacteria 28151
85 Ga0466967_0000002 3300045976 Bacteria 219994
86 Ga0495592_0115540 3300046454 Unclassified 1894
87 Ga0495603_0000546 3300046455 Bacteria 20981
88 Ga0495629_0051806 3300046459 Bacteria 2872
89 Ga0495629_0096053 3300046459 Bacteria 2067
90 Ga0495641_0000004 3300046461 Bacteria 210501
91 Ga0495641_0065356 3300046461 Unclassified 1637
92 Ga0495662_0013076 3300046476 Bacteria 4042
93 Ga0495628_0001048 3300046516 Bacteria 25310
94 Ga0495628_0087587 3300046516 Bacteria 2414
95 Ga0495644_0001688 3300046523 Bacteria 8958
96 Ga0495652_0000018 3300046529 Bacteria 201634
97 Ga0495652_0017971 3300046529 Bacteria 6308
98 Ga0495586_0000588 3300046535 Bacteria 21115
99 Ga0495587_0001456 3300046536 Bacteria 15786
100 Ga0495587_0134541 3300046536 Bacteria 1412
101 Ga0495645_0105875 3300046543 Bacteria 1995
102 Ga0495667_0000038 3300046559 Bacteria 131349
103 Ga0495635_0136662 3300046663 Bacteria 1670
104 Ga0495599_0003980 3300046678 Bacteria 8702
105 Ga0495647_0000005 3300046681 Bacteria 125996
106 Ga0495658_0015602 3300046683 Bacteria 3898
107 Ga0495669_0000248 3300046684 Bacteria 31659
108 Ga0495624_0000347 3300046690 Bacteria 36770
109 Ga0495649_0002095 3300046694 Bacteria 14310
110 Ga0495676_0000499 3300047321 Bacteria 32193
111 Ga0495676_0005983 3300047321 Bacteria 11177
112 Ga0495676_0050504 3300047321 Bacteria 3335
113 Ga0495680_0001950 3300047322 Bacteria 21725
114 Ga0495680_0005759 3300047322 Bacteria 11600
115 Ga0495679_040636 3300047446 Unclassified 1445
116 Ga0495593_0095770 3300047673 Bacteria 1526
117 Ga0495602_0004130 3300048088 Bacteria 15127
118 Ga0496100_0000001 3300048903 Bacteria 530179
119 Ga0496100_0000024 3300048903 Bacteria 116138
120 Ga0496101_0000028 3300048904 Bacteria 198664
121 Ga0496101_0000072 3300048904 Bacteria 116138
122 Ga0496102_0000129 3300048905 Bacteria 104478
123 Ga0496103_0000087 3300048906 Bacteria 104566
124 Ga0496104_0000008 3300048907 Bacteria 516976
125 Ga0496104_0000010 3300048907 Bacteria 475255
126 Ga0496104_0000230 3300048907 Bacteria 49225
127 Ga0496104_0622171 3300048907 Bacteria 989
128 Ga0496105_0000003 3300048908 Bacteria 713251
129 Ga0496105_0000005 3300048908 Bacteria 475797
130 Ga0496105_0000051 3300048908 Bacteria 90365
131 Ga0496106_0000040 3300048909 Bacteria 108754
132 Ga0496106_0000042 3300048909 Bacteria 106662
133 Ga0496106_0000134 3300048909 Bacteria 55531
134 Ga0496107_0000002 3300048910 Bacteria 320871
135 Ga0496107_0000025 3300048910 Bacteria 116138
136 Ga0496108_0000004 3300048911 Bacteria 545055
137 Ga0496109_0000013 3300048912 Bacteria 227469
138 Ga0496110_0019933 3300048913 Bacteria 5653
139 Ga0496112_0000795 3300048915 Bacteria 22289
140 Ga0496113_0000065 3300048916 Bacteria 45403
141 Ga0496113_0171880 3300048916 Bacteria 1716
142 Ga0496114_0277282 3300048917 Bacteria 1478
143 Ga0496115_0000016 3300048918 Bacteria 187067
144 Ga0496115_0019439 3300048918 Bacteria 5227
145 Ga0496119_0035230 3300048922 Bacteria 3282
146 Ga0501031_0119256 3300049568 Bacteria 1724
147 Ga0501042_0028736 3300049578 Bacteria 3922
148 Ga0501042_0321187 3300049578 Bacteria 1118
149 Ga0501070_0099788 3300049586 Bacteria 2402
150 Ga0501075_0001594 3300049591 Bacteria 14844
151 Ga0495601_0001988 3300053077 Bacteria 11450
152 Ga0495612_0001158 3300053078 Bacteria 10829
153 Ga0495612_0111762 3300053078 Unclassified 1170
154 Ga0495655_0000010 3300053083 Bacteria 125615
155 Ga0495655_0003288 3300053083 Bacteria 2653
156 Ga0495619_0000682 3300053085 Bacteria 22203
157 Ga0500614_000156 3300053123 Bacteria 17306

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046683 Ga0495658_0015602 Ga0495658_0015602_668_1588 228
2 3300045976 Ga0466967_0000002 Ga0466967_0000002_817_1740 231
3 3300048915 Ga0496112_0000795 Ga0496112_0000795_4229_5131 232
4 3300048916 Ga0496113_0000065 Ga0496113_0000065_32164_33066 232
5 3300005539 Ga0068853_100022430 Ga0068853_1000224303 233
6 3300026041 Ga0207639_10025990 Ga0207639_100259902 233
7 3300014326 Ga0157380_10000007 Ga0157380_100000074 237
8 3300048907 Ga0496104_0000230 Ga0496104_0000230_41238_41996 237
9 3300048908 Ga0496105_0000051 Ga0496105_0000051_34288_35046 237
10 3300005614 Ga0068856_100000417 Ga0068856_10000041723 239
11 3300026078 Ga0207702_10000105 Ga0207702_1000010564 239
12 3300053083 Ga0495655_0003288 Ga0495655_0003288_894_1841 239
13 3300046529 Ga0495652_0000018 Ga0495652_0000018_114682_115566 241
14 3300046536 Ga0495587_0134541 Ga0495587_0134541_201_1085 241
15 3300005340 Ga0070689_100234679 Ga0070689_1002346791 242
16 3300025936 Ga0207670_10163186 Ga0207670_101631862 242
17 3300026075 Ga0207708_10031650 Ga0207708_100316503 242
18 3300046459 Ga0495629_0051806 Ga0495629_0051806_1145_2089 243
19 3300009174 Ga0105241_10027720 Ga0105241_100277203 245
20 3300047321 Ga0495676_0050504 Ga0495676_0050504_950_1894 246
21 3300046663 Ga0495635_0136662 Ga0495635_0136662_267_1199 249
22 3300009098 Ga0105245_10109322 Ga0105245_101093223 250
23 3300025927 Ga0207687_10002108 Ga0207687_100021084 250
24 3300041486 Ga0451807_2119411 Ga0451807_2119411_85_906 250
25 3300005333 Ga0070677_10000028 Ga0070677_1000002824 251
26 3300005841 Ga0068863_100025204 Ga0068863_1000252045 251
27 3300025893 Ga0207682_10000041 Ga0207682_1000004135 251
28 3300026088 Ga0207641_10147079 Ga0207641_101470793 251
29 3300046523 Ga0495644_0001688 Ga0495644_0001688_7573_8520 252
30 3300005337 Ga0070682_100000026 Ga0070682_100000026200 253
31 3300009176 Ga0105242_10086502 Ga0105242_100865023 253
32 3300013102 Ga0157371_10015967 Ga0157371_100159671 253
33 3300048905 Ga0496102_0000129 Ga0496102_0000129_87317_88261 253
34 3300048906 Ga0496103_0000087 Ga0496103_0000087_87315_88259 253
35 3300048917 Ga0496114_0277282 Ga0496114_0277282_340_1284 253
36 3300048918 Ga0496115_0000016 Ga0496115_0000016_7218_8162 253
37 3300053078 Ga0495612_0111762 Ga0495612_0111762_198_1088 253
38 3300006881 Ga0068865_100000499 Ga0068865_1000004992 254
39 3300009101 Ga0105247_10000131 Ga0105247_1000013116 254
40 3300025900 Ga0207710_10000384 Ga0207710_1000038415 254
41 3300025938 Ga0207704_10000018 Ga0207704_10000018159 254
42 3300046476 Ga0495662_0013076 Ga0495662_0013076_2319_3266 254
43 3300046543 Ga0495645_0105875 Ga0495645_0105875_442_1386 254
44 3300013297 Ga0157378_10036953 Ga0157378_100369532 255
45 3300046516 Ga0495628_0001048 Ga0495628_0001048_19661_20545 255
46 3300048907 Ga0496104_0622171 Ga0496104_0622171_30_974 255
47 3300048909 Ga0496106_0000042 Ga0496106_0000042_87303_88223 255
48 3300009098 Ga0105245_10000040 Ga0105245_100000404 256
49 3300025927 Ga0207687_10000128 Ga0207687_1000012824 256
50 3300048088 Ga0495602_0004130 Ga0495602_0004130_400_1284 256
51 3300005937 Ga0081455_10023071 Ga0081455_100230713 257
52 3300025921 Ga0207652_10000232 Ga0207652_1000023237 257
53 3300025924 Ga0207694_10000012 Ga0207694_10000012161 257
54 3300053078 Ga0495612_0001158 Ga0495612_0001158_9044_9958 257
55 3300005530 Ga0070679_100000088 Ga0070679_10000008814 258
56 3300013308 Ga0157375_10028367 Ga0157375_100283674 258
57 3300046516 Ga0495628_0087587 Ga0495628_0087587_1379_2293 258
58 3300046529 Ga0495652_0017971 Ga0495652_0017971_191_1084 258
59 3300046678 Ga0495599_0003980 Ga0495599_0003980_1486_2400 258
60 3300053083 Ga0495655_0000010 Ga0495655_0000010_108565_109467 258
61 3300014326 Ga0157380_10003730 Ga0157380_100037308 259
62 3300046690 Ga0495624_0000347 Ga0495624_0000347_13424_14326 259
63 3300005339 Ga0070660_100104423 Ga0070660_1001044231 260
64 3300005366 Ga0070659_100021131 Ga0070659_1000211314 260
65 3300013308 Ga0157375_10003400 Ga0157375_1000340011 260
66 3300025919 Ga0207657_10143992 Ga0207657_101439922 260
67 3300044694 Ga0466963_0000141 Ga0466963_0000141_17814_18707 260
68 3300046461 Ga0495641_0065356 Ga0495641_0065356_257_1201 260
69 3300049591 Ga0501075_0001594 Ga0501075_0001594_12968_13852 260
70 3300005347 Ga0070668_100003464 Ga0070668_1000034644 261
71 3300005367 Ga0070667_100002169 Ga0070667_1000021694 261
72 3300005548 Ga0070665_100098183 Ga0070665_1000981832 261
73 3300005614 Ga0068856_100009644 Ga0068856_1000096445 261
74 3300005844 Ga0068862_100004251 Ga0068862_1000042515 261
75 3300009553 Ga0105249_10000218 Ga0105249_1000021872 261
76 3300009553 Ga0105249_10002088 Ga0105249_1000208816 261
77 3300014968 Ga0157379_10018776 Ga0157379_100187767 261
78 3300014968 Ga0157379_10036169 Ga0157379_100361692 261
79 3300025961 Ga0207712_10000027 Ga0207712_10000027265 261
80 3300025961 Ga0207712_10002074 Ga0207712_100020748 261
81 3300025972 Ga0207668_10001430 Ga0207668_100014305 261
82 3300026078 Ga0207702_10004970 Ga0207702_100049706 261
83 3300028380 Ga0268265_10021075 Ga0268265_100210752 261
84 3300046684 Ga0495669_0000248 Ga0495669_0000248_25380_26288 261
85 3300047322 Ga0495680_0001950 Ga0495680_0001950_9386_10300 261
86 3300047446 Ga0495679_040636 Ga0495679_040636_280_1197 261
87 3300048903 Ga0496100_0000024 Ga0496100_0000024_111195_112103 261
88 3300048904 Ga0496101_0000072 Ga0496101_0000072_4036_4944 261
89 3300048907 Ga0496104_0000008 Ga0496104_0000008_157521_158441 261
90 3300048908 Ga0496105_0000003 Ga0496105_0000003_157521_158441 261
91 3300048909 Ga0496106_0000040 Ga0496106_0000040_103811_104719 261
92 3300048910 Ga0496107_0000025 Ga0496107_0000025_111195_112103 261
93 3300049578 Ga0501042_0321187 Ga0501042_0321187_84_974 261
94 3300049586 Ga0501070_0099788 Ga0501070_0099788_117_1061 261
95 3300036401 Ga0373937_0066223 Ga0373937_0066223_157_1077 262
96 3300047321 Ga0495676_0000499 Ga0495676_0000499_24755_25696 262
97 3300047321 Ga0495676_0005983 Ga0495676_0005983_9164_10108 262
98 3300048903 Ga0496100_0000001 Ga0496100_0000001_51721_52665 262
99 3300048904 Ga0496101_0000028 Ga0496101_0000028_51710_52654 262
100 3300048909 Ga0496106_0000134 Ga0496106_0000134_14408_15352 262
101 3300048910 Ga0496107_0000002 Ga0496107_0000002_195823_196767 262
102 3300049578 Ga0501042_0028736 Ga0501042_0028736_2101_3015 262
103 3300028556 Ga0265337_1000167 Ga0265337_10001679 263
104 3300028558 Ga0265326_10000179 Ga0265326_1000017924 263
105 3300028654 Ga0265322_10000005 Ga0265322_10000005131 263
106 3300029957 Ga0265324_10000183 Ga0265324_1000018314 263
107 3300031238 Ga0265332_10036070 Ga0265332_100360701 263
108 3300031239 Ga0265328_10017085 Ga0265328_100170853 263
109 3300031240 Ga0265320_10000010 Ga0265320_10000010177 263
110 3300031250 Ga0265331_10000217 Ga0265331_1000021767 263
111 3300031251 Ga0265327_10000040 Ga0265327_10000040129 263
112 3300031344 Ga0265316_10031209 Ga0265316_100312091 263
113 3300031711 Ga0265314_10000578 Ga0265314_1000057823 263
114 3300047673 Ga0495593_0095770 Ga0495593_0095770_112_1023 263
115 3300049568 Ga0501031_0119256 Ga0501031_0119256_752_1699 263
116 3300009176 Ga0105242_10000063 Ga0105242_1000006319 264
117 3300025934 Ga0207686_10000230 Ga0207686_1000023019 264
118 3300025961 Ga0207712_10109101 Ga0207712_101091013 264
119 3300026121 Ga0207683_10014653 Ga0207683_100146533 264
120 3300046461 Ga0495641_0000004 Ga0495641_0000004_107212_108126 264
121 3300046559 Ga0495667_0000038 Ga0495667_0000038_11175_12104 264
122 3300047322 Ga0495680_0005759 Ga0495680_0005759_2618_3547 264
123 3300053123 Ga0500614_000156 Ga0500614_000156_16249_17163 264
124 3300005548 Ga0070665_100000022 Ga0070665_10000002248 265
125 3300005842 Ga0068858_100001140 Ga0068858_10000114020 265
126 3300009098 Ga0105245_10000857 Ga0105245_1000085727 265
127 3300009553 Ga0105249_10122516 Ga0105249_101225163 265
128 3300025927 Ga0207687_10000095 Ga0207687_1000009514 265
129 3300026035 Ga0207703_10000020 Ga0207703_10000020102 265
130 3300028379 Ga0268266_10000029 Ga0268266_10000029401 265
131 3300041512 Ga0451853_0076491 Ga0451853_0076491_4845_5780 265
132 3300046694 Ga0495649_0002095 Ga0495649_0002095_11382_12296 265
133 3300048918 Ga0496115_0019439 Ga0496115_0019439_2655_3569 266
134 3300053085 Ga0495619_0000682 Ga0495619_0000682_1884_2840 266
135 3300013296 Ga0157374_10011592 Ga0157374_100115921 267
136 3300046454 Ga0495592_0115540 Ga0495592_0115540_828_1736 267
137 3300046681 Ga0495647_0000005 Ga0495647_0000005_63829_64737 267
138 3300048907 Ga0496104_0000010 Ga0496104_0000010_245217_246155 267
139 3300048908 Ga0496105_0000005 Ga0496105_0000005_245217_246155 267
140 3300048922 Ga0496119_0035230 Ga0496119_0035230_1628_2566 267
141 3300046459 Ga0495629_0096053 Ga0495629_0096053_476_1384 268
142 3300046535 Ga0495586_0000588 Ga0495586_0000588_19300_20223 268
143 3300048913 Ga0496110_0019933 Ga0496110_0019933_4297_5211 268
144 3300048916 Ga0496113_0171880 Ga0496113_0171880_790_1704 268
145 3300053077 Ga0495601_0001988 Ga0495601_0001988_347_1261 268
146 3300005365 Ga0070688_100059651 Ga0070688_1000596513 269
147 3300009176 Ga0105242_10000378 Ga0105242_1000037823 269
148 3300025934 Ga0207686_10000517 Ga0207686_1000051713 269
149 3300025936 Ga0207670_10195874 Ga0207670_101958741 269
150 3300046455 Ga0495603_0000546 Ga0495603_0000546_12916_13788 269
151 3300046536 Ga0495587_0001456 Ga0495587_0001456_14726_15667 269
152 3300048911 Ga0496108_0000004 Ga0496108_0000004_437002_437907 269
153 3300048912 Ga0496109_0000013 Ga0496109_0000013_119443_120348 269
154 3300005719 Ga0068861_100398299 Ga0068861_1003982992 271
155 3300026118 Ga0207675_100397119 Ga0207675_1003971192 271
156 3300013307 Ga0157372_10001749 Ga0157372_100017494 274
157 3300005331 Ga0070670_100246725 Ga0070670_1002467252 275

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01551

Peptidase_M23

Peptidase family M23

179

282

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ue4-assembly1.cif.gz_B shya endopeptidase from vibrio cholerae (closed form) 0.9394 165 251
2gu1-assembly1.cif.gz_A crystal structure of a zinc containing peptidase from vibrio cholerae 0.9361 165 249
6tpi-assembly1.cif.gz_A envc bound to the ftsx periplasmic domain 0.9259 165 268
4bh5-assembly4.cif.gz_D lytm domain of envc, an activator of cell wall amidases in escherichia coli 0.9135 165 267
8c0j-assembly1.cif.gz_B structure of amib enzymatic domain bound to the envc lytm domain 0.913 165 268
ID Description Score Start End Superfamily
af_P0AFS9_286_413_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.9408 161 250 2.70.70.10
af_P71560_159_322_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.9209 157 269 2.70.70.10
4bh5D00 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.9135 165 267 2.70.70.10
af_Q2FWU3_1169_1290_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.8975 163 270 2.70.70.10
3sluA03 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.8871 161 266 2.70.70.10
ID Description Score Start End GO Terms
AF-A0A2P1P8J8-F1-model_v4 Peptidase M23 domain-containing protein 0.97 165 265 GO:0004222
AF-A0A0X8H1C3-F1-model_v4 Cpl-7 lysozyme C-terminal domain-containing protein 0.9697 165 251 GO:0004222
AF-A0A3D3ANQ2-F1-model_v4 Peptidase M23 domain-containing protein 0.969 167 267 GO:0004222
GO:0016020
AF-A0A521Y3P3-F1-model_v4 M23 family metallopeptidase 0.9585 163 251 GO:0004222
AF-A0A4Q3DJA3-F1-model_v4 deleted 0.957 167 265

Feature Viewer

pLDDT pTM Quality
68.79 0.51 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map