F226549

General Info

Members Datasets Scaffolds Average Seq Length
157 112 314 223

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_100137988|Ga0070668_1001379882
Length 232
Sequence MQHGIYASSGLPSSTVENYLKQIYVEQQSAGTGELVPMGKLASAMGVVPGTATSMVKALADSGLVSYEPRGGARLTRGGEQLALHVLRRHRLLELFLVKVLGLDWSEVHAEAEELEHAISDKVLERIDALLDRPRVDPHGDPIPPAKGKPLSDVGHRSLVTCDLRKRLRVTRVLDQNPSFLQFVERCGLTPGSQLVVESRDPNSAAVIVKPADANQATFVLDAAAKILVEAV

Samples

Sample ID Description Type Environment
1 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
16 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
22 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
23 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
24 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
25 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
36 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
37 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
62 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
63 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
64 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
65 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
66 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
67 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
68 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
69 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
70 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
71 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
72 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
73 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
74 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
75 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
76 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
77 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
78 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
79 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
80 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
81 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
82 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
83 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
84 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
85 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
86 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
87 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
88 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
89 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
90 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
91 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
101 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
102 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
103 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
104 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
105 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
107 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
108 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
109 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
110 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
111 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
112 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.64
Rhizosphere 99.36
Stem 0
Stem Tuber 0
Unclassified 7.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070668_100137988 3300005347 Bacteria 1963
2 Ga0070658_10060528 3300005327 Bacteria 3084
3 Ga0070683_100781116 3300005329 Bacteria 915
4 Ga0070670_100108463 3300005331 Unclassified 2392
5 Ga0070675_100173597 3300005354 Bacteria 1860
6 Ga0070675_100718467 3300005354 Bacteria 910
7 Ga0070671_100031816 3300005355 Bacteria 4361
8 Ga0070671_100210311 3300005355 Bacteria 1650
9 Ga0070674_100007179 3300005356 Bacteria 6557
10 Ga0070667_100230572 3300005367 Bacteria 1651
11 Ga0070667_100884426 3300005367 Unclassified 831
12 Ga0070709_10173159 3300005434 Bacteria 1510
13 Ga0070714_100007132 3300005435 Bacteria 8671
14 Ga0070714_100413307 3300005435 Bacteria 1277
15 Ga0070672_100034201 3300005543 Bacteria 3856
16 Ga0070672_100438229 3300005543 Bacteria 1124
17 Ga0070665_100001675 3300005548 Bacteria 25533
18 Ga0070665_100473860 3300005548 Bacteria 1262
19 Ga0068855_100068802 3300005563 Bacteria 4121
20 Ga0068855_100419086 3300005563 Bacteria 1465
21 Ga0068857_100010837 3300005577 Bacteria 7936
22 Ga0068852_100835531 3300005616 Bacteria 936
23 Ga0068864_100192598 3300005618 Bacteria 1870
24 Ga0068864_100557852 3300005618 Bacteria 1108
25 Ga0068863_100161770 3300005841 Bacteria 2145
26 Ga0068858_101148439 3300005842 Bacteria 763
27 Ga0068860_100115343 3300005843 Bacteria 2569
28 Ga0068860_100279208 3300005843 Bacteria 1632
29 Ga0068860_100695597 3300005843 Unclassified 1026
30 Ga0068860_101012725 3300005843 Bacteria 849
31 Ga0068862_100165088 3300005844 Bacteria 1979
32 Ga0081538_10010646 3300005981 Bacteria 7526
33 Ga0075433_10023717 3300006852 Bacteria 5167
34 Ga0075434_100313007 3300006871 Bacteria 1590
35 Ga0075436_100024853 3300006914 Bacteria 4119
36 Ga0075435_100064677 3300007076 Bacteria 2972
37 Ga0075435_100394724 3300007076 Unclassified 1189
38 Ga0105240_10124632 3300009093 Bacteria 3098
39 Ga0105245_10119217 3300009098 Bacteria 2463
40 Ga0114129_10122863 3300009147 Unclassified 3572
41 Ga0114129_10694352 3300009147 Bacteria 1308
42 Ga0105241_10017510 3300009174 Bacteria 5267
43 Ga0105248_11679112 3300009177 Bacteria 720
44 Ga0105239_10014037 3300010375 Bacteria 8892
45 Ga0105239_10157823 3300010375 Bacteria 2534
46 Ga0157371_10204166 3300013102 Bacteria 1417
47 Ga0157369_10033607 3300013105 Bacteria 5636
48 Ga0157369_10049485 3300013105 Bacteria 4556
49 Ga0157369_10094886 3300013105 Bacteria 3184
50 Ga0157369_10813749 3300013105 Bacteria 960
51 Ga0157372_10070131 3300013307 Bacteria 3943
52 Ga0157372_10349472 3300013307 Bacteria 1722
53 Ga0157372_10356953 3300013307 Bacteria 1703
54 Ga0157380_11172666 3300014326 Bacteria 811
55 Ga0157376_11091168 3300014969 Bacteria 824
56 Ga0207682_10058432 3300025893 Bacteria 1610
57 Ga0207645_10109434 3300025907 Bacteria 1788
58 Ga0207684_10244339 3300025910 Bacteria 1549
59 Ga0207654_10040742 3300025911 Bacteria 2618
60 Ga0207659_10117097 3300025926 Bacteria 2035
61 Ga0207687_10366534 3300025927 Bacteria 1177
62 Ga0207700_10065035 3300025928 Bacteria 2781
63 Ga0207664_10050875 3300025929 Bacteria 3269
64 Ga0207644_10167879 3300025931 Bacteria 1711
65 Ga0207669_10014664 3300025937 Bacteria 3934
66 Ga0207691_10026564 3300025940 Bacteria 5432
67 Ga0207667_10144317 3300025949 Bacteria 2451
68 Ga0207651_10042004 3300025960 Bacteria 3040
69 Ga0207651_10300372 3300025960 Bacteria 1335
70 Ga0207658_10247761 3300025986 Bacteria 1512
71 Ga0207703_10598607 3300026035 Unclassified 1043
72 Ga0207703_11049595 3300026035 Bacteria 782
73 Ga0207641_10070384 3300026088 Bacteria 3006
74 Ga0207676_10153673 3300026095 Bacteria 1985
75 Ga0207674_10003756 3300026116 Bacteria 18524
76 Ga0207675_100162119 3300026118 Bacteria 2133
77 Ga0207683_10396127 3300026121 Bacteria 1270
78 Ga0207698_10816272 3300026142 Bacteria 936
79 Ga0268266_10001325 3300028379 Bacteria 30013
80 Ga0268265_10126766 3300028380 Bacteria 2114
81 Ga0268264_10030542 3300028381 Bacteria 4417
82 Ga0268264_10072682 3300028381 Bacteria 2917
83 Ga0268264_10762506 3300028381 Unclassified 965
84 Ga0268264_10846699 3300028381 Bacteria 916
85 Ga0307409_100667549 3300031995 Bacteria 1035
86 Ga0373927_0307216 3300035695 Unclassified 1044
87 Ga0373937_0020023 3300036401 Bacteria 5994
88 Ga0373937_0253786 3300036401 Bacteria 1658
89 Ga0395900_0544062 3300037418 Bacteria 1107
90 Ga0395905_0184459 3300037471 Unclassified 1959
91 Ga0395905_0243555 3300037471 Bacteria 1680
92 Ga0395905_0352102 3300037471 Bacteria 1365
93 Ga0395901_0022807 3300038443 Bacteria 6418
94 Ga0395901_0092114 3300038443 Bacteria 3173
95 Ga0451807_1244011 3300041486 Bacteria 1777
96 Ga0451577_0000745 3300042876 Bacteria 50021
97 Ga0451577_0537897 3300042876 Bacteria 1061
98 Ga0466972_0058521 3300044658 Bacteria 1850
99 Ga0453683_0208295 3300044673 Bacteria 1242
100 Ga0451576_0000274 3300045051 Bacteria 126413
101 Ga0495603_0201452 3300046455 Bacteria 1150
102 Ga0495629_0016462 3300046459 Bacteria 5308
103 Ga0495582_0124157 3300046473 Bacteria 1456
104 Ga0495639_0020423 3300046475 Bacteria 2894
105 Ga0495594_0191430 3300046499 Bacteria 1165
106 Ga0495630_0006895 3300046517 Bacteria 8100
107 Ga0495666_0114953 3300046526 Bacteria 1263
108 Ga0495652_0141179 3300046529 Bacteria 1894
109 Ga0495634_0152906 3300046642 Unclassified 1458
110 Ga0495635_0130767 3300046663 Bacteria 1711
111 Ga0495599_0233871 3300046678 Bacteria 1122
112 Ga0495658_0166114 3300046683 Bacteria 1364
113 Ga0495613_0041107 3300046689 Bacteria 3424
114 Ga0495624_0003951 3300046690 Bacteria 10915
115 Ga0495581_0078824 3300047315 Bacteria 1906
116 Ga0495674_0031358 3300047319 Bacteria 4829
117 Ga0495676_0010953 3300047321 Bacteria 8199
118 Ga0495684_0001583 3300047471 Bacteria 18237
119 Ga0495684_0232696 3300047471 Bacteria 1347
120 Ga0495614_0033291 3300048089 Bacteria 2217
121 Ga0501032_0114026 3300049569 Bacteria 1788
122 Ga0501034_0000396 3300049571 Bacteria 73608
123 Ga0501034_0000418 3300049571 Bacteria 71416
124 Ga0501034_0000847 3300049571 Bacteria 45283
125 Ga0501034_0093881 3300049571 Bacteria 2997
126 Ga0501037_0000737 3300049573 Bacteria 24864
127 Ga0501038_0000081 3300049574 Bacteria 81017
128 Ga0501039_0071010 3300049575 Bacteria 2705
129 Ga0501043_0000150 3300049579 Bacteria 65001
130 Ga0501043_0445959 3300049579 Bacteria 973
131 Ga0501043_0727094 3300049579 Bacteria 723
132 Ga0501046_0000015 3300049580 Bacteria 242157
133 Ga0501047_0003166 3300049581 Bacteria 15599
134 Ga0501047_0010648 3300049581 Bacteria 8693
135 Ga0501048_0001081 3300049582 Bacteria 20429
136 Ga0501068_0392970 3300049584 Bacteria 894
137 Ga0501071_0485651 3300049587 Bacteria 947
138 Ga0501073_0522880 3300049589 Bacteria 820
139 Ga0501080_0008050 3300049742 Bacteria 9550
140 Ga0501080_0158315 3300049742 Bacteria 2092
141 Ga0501083_0000015 3300049744 Bacteria 175355
142 Ga0501083_0001039 3300049744 Bacteria 18497
143 Ga0501083_0008952 3300049744 Bacteria 7067
144 Ga0501035_0012298 3300049822 Bacteria 7913
145 Ga0501044_0000375 3300049823 Bacteria 55734
146 Ga0501044_0001672 3300049823 Bacteria 26049
147 Ga0501044_0096974 3300049823 Bacteria 2970
148 Ga0501044_0213174 3300049823 Unclassified 1884
149 Ga0501044_0278385 3300049823 Bacteria 1607
150 Ga0501044_0815239 3300049823 Bacteria 812
151 nmdc:mga05p37_481669_c1 3300050507 Bacteria 1429
152 nmdc:mga0rr50_381414_c1 3300050513 Unclassified 1189
153 nmdc:mga0rr50_79825_c1 3300050513 Bacteria 2521
154 nmdc:mga08x19_92880_c1 3300050514 Bacteria 1994
155 Ga0495619_0075235 3300053085 Bacteria 2266
156 Ga0501084_0098912 3300054114 Bacteria 2450
157 Ga0501082_0233336 3300060353 Bacteria 1601
158 Ga0070668_100137988
159 Ga0070658_10060528
160 Ga0070683_100781116
161 Ga0070670_100108463
162 Ga0070675_100173597
163 Ga0070675_100718467
164 Ga0070671_100031816
165 Ga0070671_100210311
166 Ga0070674_100007179
167 Ga0070667_100230572
168 Ga0070667_100884426
169 Ga0070709_10173159
170 Ga0070714_100007132
171 Ga0070714_100413307
172 Ga0070672_100034201
173 Ga0070672_100438229
174 Ga0070665_100001675
175 Ga0070665_100473860
176 Ga0068855_100068802
177 Ga0068855_100419086
178 Ga0068857_100010837
179 Ga0068852_100835531
180 Ga0068864_100192598
181 Ga0068864_100557852
182 Ga0068863_100161770
183 Ga0068858_101148439
184 Ga0068860_100115343
185 Ga0068860_100279208
186 Ga0068860_100695597
187 Ga0068860_101012725
188 Ga0068862_100165088
189 Ga0081538_10010646
190 Ga0075433_10023717
191 Ga0075434_100313007
192 Ga0075436_100024853
193 Ga0075435_100064677
194 Ga0075435_100394724
195 Ga0105240_10124632
196 Ga0105245_10119217
197 Ga0114129_10122863
198 Ga0114129_10694352
199 Ga0105241_10017510
200 Ga0105248_11679112
201 Ga0105239_10014037
202 Ga0105239_10157823
203 Ga0157371_10204166
204 Ga0157369_10033607
205 Ga0157369_10049485
206 Ga0157369_10094886
207 Ga0157369_10813749
208 Ga0157372_10070131
209 Ga0157372_10349472
210 Ga0157372_10356953
211 Ga0157380_11172666
212 Ga0157376_11091168
213 Ga0207682_10058432
214 Ga0207645_10109434
215 Ga0207684_10244339
216 Ga0207654_10040742
217 Ga0207659_10117097
218 Ga0207687_10366534
219 Ga0207700_10065035
220 Ga0207664_10050875
221 Ga0207644_10167879
222 Ga0207669_10014664
223 Ga0207691_10026564
224 Ga0207667_10144317
225 Ga0207651_10042004
226 Ga0207651_10300372
227 Ga0207658_10247761
228 Ga0207703_10598607
229 Ga0207703_11049595
230 Ga0207641_10070384
231 Ga0207676_10153673
232 Ga0207674_10003756
233 Ga0207675_100162119
234 Ga0207683_10396127
235 Ga0207698_10816272
236 Ga0268266_10001325
237 Ga0268265_10126766
238 Ga0268264_10030542
239 Ga0268264_10072682
240 Ga0268264_10762506
241 Ga0268264_10846699
242 Ga0307409_100667549
243 Ga0373927_0307216
244 Ga0373937_0020023
245 Ga0373937_0253786
246 Ga0395900_0544062
247 Ga0395905_0184459
248 Ga0395905_0243555
249 Ga0395905_0352102
250 Ga0395901_0022807
251 Ga0395901_0092114
252 Ga0451807_1244011
253 Ga0451577_0000745
254 Ga0451577_0537897
255 Ga0466972_0058521
256 Ga0453683_0208295
257 Ga0451576_0000274
258 Ga0495603_0201452
259 Ga0495629_0016462
260 Ga0495582_0124157
261 Ga0495639_0020423
262 Ga0495594_0191430
263 Ga0495630_0006895
264 Ga0495666_0114953
265 Ga0495652_0141179
266 Ga0495634_0152906
267 Ga0495635_0130767
268 Ga0495599_0233871
269 Ga0495658_0166114
270 Ga0495613_0041107
271 Ga0495624_0003951
272 Ga0495581_0078824
273 Ga0495674_0031358
274 Ga0495676_0010953
275 Ga0495684_0001583
276 Ga0495684_0232696
277 Ga0495614_0033291
278 Ga0501032_0114026
279 Ga0501034_0000396
280 Ga0501034_0000418
281 Ga0501034_0000847
282 Ga0501034_0093881
283 Ga0501037_0000737
284 Ga0501038_0000081
285 Ga0501039_0071010
286 Ga0501043_0000150
287 Ga0501043_0445959
288 Ga0501043_0727094
289 Ga0501046_0000015
290 Ga0501047_0003166
291 Ga0501047_0010648
292 Ga0501048_0001081
293 Ga0501068_0392970
294 Ga0501071_0485651
295 Ga0501073_0522880
296 Ga0501080_0008050
297 Ga0501080_0158315
298 Ga0501083_0000015
299 Ga0501083_0001039
300 Ga0501083_0008952
301 Ga0501035_0012298
302 Ga0501044_0000375
303 Ga0501044_0001672
304 Ga0501044_0096974
305 Ga0501044_0213174
306 Ga0501044_0278385
307 Ga0501044_0815239
308 nmdc:mga05p37_481669_c1
309 nmdc:mga0rr50_381414_c1
310 nmdc:mga0rr50_79825_c1
311 nmdc:mga08x19_92880_c1
312 Ga0495619_0075235
313 Ga0501084_0098912
314 Ga0501082_0233336

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02742

Fe_dep_repr_C

Iron dependent repressor, metal binding and dimerisation domain

76

145

0.98

PF04023

FeoA

FeoA domain

157

231

0.91

PF01325

Fe_dep_repress

Iron dependent repressor, N-terminal DNA binding domain

13

73

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zr4-assembly1.cif.gz_A manganese-dependent transcriptional repressor 0.9478 17 231
5zr4-assembly1.cif.gz_A manganese-dependent transcriptional repressor 0.938 17 231
2isy-assembly1.cif.gz_B crystal structure of the nickel-activated two-domain iron-dependent regulator (ider) 0.9368 15 144
1on1-assembly1.cif.gz_A bacillus subtilis manganese transport regulator (mntr) bound to manganese, ab conformation. 0.9339 14 133
2ev0-assembly1.cif.gz_B bacillus subtilis manganese transport regulator (mntr) bound to cadmium 0.9332 14 133
ID Description Score Start End Superfamily
1ddnD02 Mainly Alpha;Orthogonal Bundle;Diphtheria Toxin Repressor; domain 2;Iron dependent repressor, metal binding and dimerisation domain 0.9611 88 130 1.10.60.10
1ddnC02 Mainly Alpha;Orthogonal Bundle;Diphtheria Toxin Repressor; domain 2;Iron dependent repressor, metal binding and dimerisation domain 0.9607 88 130 1.10.60.10
1u8rD02 Mainly Alpha;Orthogonal Bundle;Diphtheria Toxin Repressor; domain 2;Iron dependent repressor, metal binding and dimerisation domain 0.9593 86 146 1.10.60.10
1fx7A02 Mainly Alpha;Orthogonal Bundle;Diphtheria Toxin Repressor; domain 2;Iron dependent repressor, metal binding and dimerisation domain 0.9585 86 145 1.10.60.10
1f5tA02 Mainly Alpha;Orthogonal Bundle;Diphtheria Toxin Repressor; domain 2;Iron dependent repressor, metal binding and dimerisation domain 0.9565 88 131 1.10.60.10
ID Description Score Start End GO Terms
AF-A0A356FRH3-F1-model_v4 Metal-dependent transcriptional regulator 0.9819 93 229 GO:0046914
GO:0046983
AF-A0A3B9G6S9-F1-model_v4 Manganese transport regulator 0.9759 14 134 GO:0003677
GO:0003700
GO:0046914
GO:0046983
AF-A0A7V9D821-F1-model_v4 Manganese transport regulator 0.975 14 117 GO:0003677
GO:0003700
GO:0046914
GO:0046983
AF-A0A4R5GD27-F1-model_v4 Manganese transport regulator 0.9744 14 231 GO:0003677
GO:0003700
GO:0005737
GO:0046914
GO:0046983
AF-A0A7V9CHS7-F1-model_v4 Transcriptional regulator MntR (Manganese transport regulator) 0.9732 14 231 GO:0003677
GO:0003700
GO:0005737
GO:0046914
GO:0046983

Map