F225929

General Info

Members Datasets Scaffolds Average Seq Length
156 115 312 295

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_558315_c1|nmdc:mga0n895_558315_c1_113_994
Length 293
Sequence VPELPDVTVYVEALAARVVGQAMTSASLKSPFVLRSVTPPLDALNGKKVSGVRRVGKRIVLAFDDQLFLVIHLMIAGRLRWREPGEKLGFGGKMLLASFAFPNGTLFLTEASSKKRASIEVVHGEAALDRLNPGGLEPLASTLEQFSAALTRENHTVKRALTDPHLFSGIGNAYSDEILHAARLSPLKLTQSMTAEEIARLHDATRATLVVWIDQLRRELGGGFPEKVTAFRDAMAVHGRFKQPCPVCGAPVQRIVYAENECNYCARCQTGGRVLADRSLSRLLKDDWPRELS

Samples

Sample ID Description Type Environment
1 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
72 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
73 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
74 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
75 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
76 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
77 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
78 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
79 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
80 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
81 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
82 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
84 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
85 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
86 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
87 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
88 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
89 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
90 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
91 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
92 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
93 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
94 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
95 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
96 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
99 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
100 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
101 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
102 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
103 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
104 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
105 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
107 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
108 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
109 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
110 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
111 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
112 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
113 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
114 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
115 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.64
Nodule 0
Rhizoplane 1.92
Rhizosphere 97.44
Stem 0
Stem Tuber 0
Unclassified 1.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0n895_558315_c1 3300050512 Bacteria 1150
2 Ga0070658_10037139 3300005327 Bacteria 3926
3 Ga0070690_100359675 3300005330 Bacteria 1059
4 Ga0068869_100330993 3300005334 Bacteria 1237
5 Ga0068868_100008083 3300005338 Bacteria 7524
6 Ga0070689_100067817 3300005340 Bacteria 2782
7 Ga0070689_100197857 3300005340 Bacteria 1639
8 Ga0070689_100251541 3300005340 Bacteria 1458
9 Ga0070675_100046273 3300005354 Bacteria 3562
10 Ga0070674_100169574 3300005356 Bacteria 1663
11 Ga0070714_100036822 3300005435 Bacteria 4107
12 Ga0070701_10013084 3300005438 Bacteria 3763
13 Ga0070708_100000095 3300005445 Bacteria 58224
14 Ga0070678_100121306 3300005456 Bacteria 2062
15 Ga0070681_10018930 3300005458 Bacteria 6890
16 Ga0068867_100156054 3300005459 Bacteria 1797
17 Ga0070707_100304121 3300005468 Bacteria 1550
18 Ga0070684_100187725 3300005535 Bacteria 1880
19 Ga0068855_100042257 3300005563 Bacteria 5401
20 Ga0068855_100239920 3300005563 Bacteria 2026
21 Ga0068856_100019190 3300005614 Bacteria 6637
22 Ga0068852_100002790 3300005616 Bacteria 12102
23 Ga0068859_100063438 3300005617 Bacteria 3726
24 Ga0068859_100114420 3300005617 Bacteria 2762
25 Ga0068864_100137043 3300005618 Bacteria 2205
26 Ga0068851_10001782 3300005834 Bacteria 9416
27 Ga0068863_100093834 3300005841 Bacteria 2848
28 Ga0081539_10135656 3300005985 Bacteria 1203
29 Ga0070716_100187493 3300006173 Bacteria 1364
30 Ga0097621_100012268 3300006237 Bacteria 6341
31 Ga0097621_100048722 3300006237 Bacteria 3439
32 Ga0068871_100008164 3300006358 Bacteria 7522
33 Ga0068871_100017675 3300006358 Bacteria 5401
34 Ga0075428_100042215 3300006844 Bacteria 5016
35 Ga0075428_100044336 3300006844 Bacteria 4887
36 Ga0075433_10006537 3300006852 Bacteria 9224
37 Ga0075434_100010757 3300006871 Bacteria 8593
38 Ga0075434_100323060 3300006871 Bacteria 1564
39 Ga0075436_100002436 3300006914 Bacteria 12815
40 Ga0075436_100027731 3300006914 Bacteria 3898
41 Ga0097620_100063439 3300006931 Bacteria 3726
42 Ga0097620_100114416 3300006931 Bacteria 2762
43 Ga0075435_100001038 3300007076 Bacteria 17578
44 Ga0075435_100035261 3300007076 Bacteria 3970
45 Ga0075435_100383694 3300007076 Bacteria 1207
46 Ga0105240_10020139 3300009093 Bacteria 8904
47 Ga0105240_10028389 3300009093 Bacteria 7310
48 Ga0105240_10248118 3300009093 Bacteria 2060
49 Ga0111539_10019151 3300009094 Bacteria 8456
50 Ga0111539_10150459 3300009094 Unclassified 2725
51 Ga0111539_10482361 3300009094 Unclassified 1444
52 Ga0105245_10363183 3300009098 Bacteria 1437
53 Ga0105245_10472063 3300009098 Bacteria 1266
54 Ga0114129_10000027 3300009147 Bacteria 112969
55 Ga0114129_10283924 3300009147 Bacteria 2211
56 Ga0105241_10016635 3300009174 Bacteria 5397
57 Ga0105242_10017281 3300009176 Bacteria 5618
58 Ga0105248_10061420 3300009177 Bacteria 4219
59 Ga0105248_10307437 3300009177 Bacteria 1785
60 Ga0105238_10233316 3300009551 Bacteria 1816
61 Ga0105238_10268083 3300009551 Bacteria 1688
62 Ga0157370_10011468 3300013104 Bacteria 9264
63 Ga0157378_10062620 3300013297 Bacteria 3322
64 Ga0157378_10365001 3300013297 Bacteria 1414
65 Ga0163162_10175004 3300013306 Bacteria 2271
66 Ga0163162_10445956 3300013306 Bacteria 1426
67 Ga0157372_10195105 3300013307 Bacteria 2346
68 Ga0157375_10030825 3300013308 Bacteria 5062
69 Ga0163163_10674463 3300014325 Bacteria 1097
70 Ga0157380_10172489 3300014326 Bacteria 1891
71 Ga0157379_10057397 3300014968 Bacteria 3479
72 Ga0157376_10070197 3300014969 Bacteria 2972
73 Ga0207705_10022203 3300025909 Bacteria 4527
74 Ga0207707_10159045 3300025912 Bacteria 1975
75 Ga0207695_10007386 3300025913 Bacteria 14020
76 Ga0207695_10388127 3300025913 Bacteria 1281
77 Ga0207652_10060435 3300025921 Bacteria 3269
78 Ga0207646_10347824 3300025922 Bacteria 1340
79 Ga0207694_10117340 3300025924 Bacteria 2122
80 Ga0207694_10432815 3300025924 Bacteria 1097
81 Ga0207659_10081164 3300025926 Bacteria 2397
82 Ga0207687_10052477 3300025927 Bacteria 2846
83 Ga0207687_10203650 3300025927 Bacteria 1548
84 Ga0207686_10139934 3300025934 Bacteria 1671
85 Ga0207669_10221980 3300025937 Bacteria 1388
86 Ga0207691_10049788 3300025940 Bacteria 3839
87 Ga0207711_10418380 3300025941 Bacteria 1246
88 Ga0207689_10099473 3300025942 Bacteria 2390
89 Ga0207667_10036563 3300025949 Bacteria 5262
90 Ga0207667_10128061 3300025949 Bacteria 2615
91 Ga0207667_10286519 3300025949 Bacteria 1683
92 Ga0207677_10004776 3300026023 Bacteria 7311
93 Ga0207677_10269668 3300026023 Bacteria 1392
94 Ga0207708_10232657 3300026075 Bacteria 1480
95 Ga0207702_10015304 3300026078 Bacteria 6359
96 Ga0207641_10411130 3300026088 Bacteria 1301
97 Ga0207648_10109764 3300026089 Bacteria 2422
98 Ga0207698_10010778 3300026142 Bacteria 5896
99 Ga0207698_10048063 3300026142 Bacteria 3237
100 Ga0265330_10007892 3300031235 Bacteria 5157
101 Ga0265332_10000401 3300031238 Bacteria 31298
102 Ga0265328_10071284 3300031239 Bacteria 1277
103 Ga0265331_10000262 3300031250 Bacteria 60603
104 Ga0265327_10010517 3300031251 Bacteria 6495
105 Ga0265316_10018188 3300031344 Bacteria 6048
106 Ga0265314_10043674 3300031711 Bacteria 3185
107 Ga0265342_10021097 3300031712 Bacteria 4167
108 Ga0307411_10291087 3300032005 Bacteria 1305
109 Ga0373940_0047178 3300035088 Bacteria 1201
110 Ga0373962_0039985 3300035242 Bacteria 1318
111 Ga0373937_0093351 3300036401 Bacteria 2790
112 Ga0373937_0220987 3300036401 Bacteria 1783
113 Ga0395900_0017004 3300037418 Bacteria 7424
114 Ga0395905_0068853 3300037471 Bacteria 3315
115 Ga0436360_1088161 3300039438 Bacteria 1002
116 Ga0495592_0066260 3300046454 Bacteria 2643
117 Ga0495653_0108883 3300046463 Bacteria 1995
118 Ga0495628_0058117 3300046516 Bacteria 3041
119 Ga0495586_0255050 3300046535 Bacteria 1001
120 Ga0495621_0020210 3300046539 Bacteria 2183
121 Ga0495635_0040799 3300046663 Bacteria 3207
122 Ga0495623_0130781 3300046679 Bacteria 1503
123 Ga0496104_0042894 3300048907 Bacteria 4248
124 Ga0496105_0082804 3300048908 Bacteria 2650
125 Ga0496110_0037593 3300048913 Bacteria 4208
126 Ga0501046_0038253 3300049580 Bacteria 3852
127 Ga0501047_0003041 3300049581 Bacteria 15910
128 Ga0501047_0005080 3300049581 Bacteria 12350
129 Ga0501069_0000613 3300049585 Bacteria 16520
130 Ga0501070_0001894 3300049586 Bacteria 18500
131 Ga0501070_0551847 3300049586 Bacteria 922
132 Ga0501073_0001098 3300049589 Bacteria 19610
133 Ga0501074_0000270 3300049590 Bacteria 29630
134 Ga0501075_0158797 3300049591 Bacteria 1725
135 Ga0501075_0438372 3300049591 Bacteria 996
136 Ga0501080_0034184 3300049742 Bacteria 4744
137 Ga0501083_0001697 3300049744 Bacteria 15011
138 Ga0501035_0121975 3300049822 Bacteria 2278
139 Ga0501044_0003092 3300049823 Bacteria 18842
140 Ga0501044_0021513 3300049823 Bacteria 6879
141 nmdc:mga06z11_410229_c1 3300050494 Bacteria 816
142 nmdc:mga05p37_1448_c1 3300050507 Bacteria 27600
143 nmdc:mga06r32_283305_c1 3300050510 Bacteria 1644
144 nmdc:mga08y16_149473_c1 3300050511 Unclassified 2428
145 nmdc:mga0n895_107343_c1 3300050512 Bacteria 2805
146 nmdc:mga0n895_148472_c1 3300050512 Bacteria 2374
147 nmdc:mga0n895_5548_c1 3300050512 Bacteria 10563
148 nmdc:mga0rr50_104658_c1 3300050513 Bacteria 2230
149 nmdc:mga0rr50_36703_c1 3300050513 Bacteria 3531
150 nmdc:mga08x19_375_c1 3300050514 Bacteria 31351
151 nmdc:mga08x19_83891_c1 3300050514 Bacteria 2095
152 nmdc:mga0a205_194595_c1 3300050515 Bacteria 1919
153 nmdc:mga0a205_70542_c1 3300050515 Bacteria 3374
154 nmdc:mga0a205_93598_c1 3300050515 Bacteria 2903
155 Ga0590071_038757 3300059421 Bacteria 1145
156 Ga0501082_0196201 3300060353 Bacteria 1756
157 nmdc:mga0n895_558315_c1
158 Ga0070658_10037139
159 Ga0070690_100359675
160 Ga0068869_100330993
161 Ga0068868_100008083
162 Ga0070689_100067817
163 Ga0070689_100197857
164 Ga0070689_100251541
165 Ga0070675_100046273
166 Ga0070674_100169574
167 Ga0070714_100036822
168 Ga0070701_10013084
169 Ga0070708_100000095
170 Ga0070678_100121306
171 Ga0070681_10018930
172 Ga0068867_100156054
173 Ga0070707_100304121
174 Ga0070684_100187725
175 Ga0068855_100042257
176 Ga0068855_100239920
177 Ga0068856_100019190
178 Ga0068852_100002790
179 Ga0068859_100063438
180 Ga0068859_100114420
181 Ga0068864_100137043
182 Ga0068851_10001782
183 Ga0068863_100093834
184 Ga0081539_10135656
185 Ga0070716_100187493
186 Ga0097621_100012268
187 Ga0097621_100048722
188 Ga0068871_100008164
189 Ga0068871_100017675
190 Ga0075428_100042215
191 Ga0075428_100044336
192 Ga0075433_10006537
193 Ga0075434_100010757
194 Ga0075434_100323060
195 Ga0075436_100002436
196 Ga0075436_100027731
197 Ga0097620_100063439
198 Ga0097620_100114416
199 Ga0075435_100001038
200 Ga0075435_100035261
201 Ga0075435_100383694
202 Ga0105240_10020139
203 Ga0105240_10028389
204 Ga0105240_10248118
205 Ga0111539_10019151
206 Ga0111539_10150459
207 Ga0111539_10482361
208 Ga0105245_10363183
209 Ga0105245_10472063
210 Ga0114129_10000027
211 Ga0114129_10283924
212 Ga0105241_10016635
213 Ga0105242_10017281
214 Ga0105248_10061420
215 Ga0105248_10307437
216 Ga0105238_10233316
217 Ga0105238_10268083
218 Ga0157370_10011468
219 Ga0157378_10062620
220 Ga0157378_10365001
221 Ga0163162_10175004
222 Ga0163162_10445956
223 Ga0157372_10195105
224 Ga0157375_10030825
225 Ga0163163_10674463
226 Ga0157380_10172489
227 Ga0157379_10057397
228 Ga0157376_10070197
229 Ga0207705_10022203
230 Ga0207707_10159045
231 Ga0207695_10007386
232 Ga0207695_10388127
233 Ga0207652_10060435
234 Ga0207646_10347824
235 Ga0207694_10117340
236 Ga0207694_10432815
237 Ga0207659_10081164
238 Ga0207687_10052477
239 Ga0207687_10203650
240 Ga0207686_10139934
241 Ga0207669_10221980
242 Ga0207691_10049788
243 Ga0207711_10418380
244 Ga0207689_10099473
245 Ga0207667_10036563
246 Ga0207667_10128061
247 Ga0207667_10286519
248 Ga0207677_10004776
249 Ga0207677_10269668
250 Ga0207708_10232657
251 Ga0207702_10015304
252 Ga0207641_10411130
253 Ga0207648_10109764
254 Ga0207698_10010778
255 Ga0207698_10048063
256 Ga0265330_10007892
257 Ga0265332_10000401
258 Ga0265328_10071284
259 Ga0265331_10000262
260 Ga0265327_10010517
261 Ga0265316_10018188
262 Ga0265314_10043674
263 Ga0265342_10021097
264 Ga0307411_10291087
265 Ga0373940_0047178
266 Ga0373962_0039985
267 Ga0373937_0093351
268 Ga0373937_0220987
269 Ga0395900_0017004
270 Ga0395905_0068853
271 Ga0436360_1088161
272 Ga0495592_0066260
273 Ga0495653_0108883
274 Ga0495628_0058117
275 Ga0495586_0255050
276 Ga0495621_0020210
277 Ga0495635_0040799
278 Ga0495623_0130781
279 Ga0496104_0042894
280 Ga0496105_0082804
281 Ga0496110_0037593
282 Ga0501046_0038253
283 Ga0501047_0003041
284 Ga0501047_0005080
285 Ga0501069_0000613
286 Ga0501070_0001894
287 Ga0501070_0551847
288 Ga0501073_0001098
289 Ga0501074_0000270
290 Ga0501075_0158797
291 Ga0501075_0438372
292 Ga0501080_0034184
293 Ga0501083_0001697
294 Ga0501035_0121975
295 Ga0501044_0003092
296 Ga0501044_0021513
297 nmdc:mga06z11_410229_c1
298 nmdc:mga05p37_1448_c1
299 nmdc:mga06r32_283305_c1
300 nmdc:mga08y16_149473_c1
301 nmdc:mga0n895_107343_c1
302 nmdc:mga0n895_148472_c1
303 nmdc:mga0n895_5548_c1
304 nmdc:mga0rr50_104658_c1
305 nmdc:mga0rr50_36703_c1
306 nmdc:mga08x19_375_c1
307 nmdc:mga08x19_83891_c1
308 nmdc:mga0a205_194595_c1
309 nmdc:mga0a205_70542_c1
310 nmdc:mga0a205_93598_c1
311 Ga0590071_038757
312 Ga0501082_0196201

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06827

zf-FPG_IleRS

Zinc finger found in FPG and IleRS

242

271

0.96

PF06831

H2TH

Formamidopyrimidine-DNA glycosylase H2TH domain

135

218

0.91

PF01149

Fapy_DNA_glyco

Formamidopyrimidine-DNA glycosylase N-terminal domain

1

112

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7nhm-assembly1.cif.gz_n 70s ribosome from staphylococcus aureus 0.9395 170 204
4v5r-assembly1.cif.gz_AM the crystal structure of ef-tu and trp-trna-trp bound to a cognate codon on the 70s ribosome. 0.9177 170 203
6yef-assembly1.cif.gz_m 70s initiation complex with assigned rrna modifications from staphylococcus aureus 0.9175 170 203
1kfv-assembly2.cif.gz_B crystal structure of lactococcus lactis formamido-pyrimidine dna glycosylase (alias fpg or mutm) non covalently bound to an ap site containing dna. 0.8784 3 270
1tdz-assembly1.cif.gz_A crystal structure complex between the lactococcus lactis fpg (mutm) and a fapy-dg containing dna 0.8757 3 270
ID Description Score Start End Superfamily
2y10M01 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9177 170 203 1.10.8.50
3sarA02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9109 135 269 1.10.8.50
3sarA02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.8896 135 269 1.10.8.50
1kfvB01 Alpha Beta;Alpha-Beta Barrel;N-terminal domain of MutM-like DNA repair proteins;MutM-like, N-terminal 0.877 3 131 3.20.190.10
af_L0T864_10_149_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.8685 135 276 1.10.8.50
ID Description Score Start End GO Terms
AF-A0A2V6X5E8-F1-model_v4 Formamidopyrimidine-DNA glycosylase 0.979 1 216 GO:0003684
GO:0006284
GO:0008270
GO:0034039
GO:0140078
AF-A0A2V6X5E8-F1-model_v4 Formamidopyrimidine-DNA glycosylase 0.9745 1 216 GO:0003684
GO:0006284
GO:0008270
GO:0034039
GO:0140078
AF-A0A7C4U9B8-F1-model_v4 Formamidopyrimidine-DNA glycosylase 0.9743 1 270 GO:0003684
GO:0006284
GO:0008270
GO:0034039
GO:0140078
AF-A0A7C4U9B8-F1-model_v4 Formamidopyrimidine-DNA glycosylase 0.9707 1 270 GO:0003684
GO:0006284
GO:0008270
GO:0034039
GO:0140078
AF-A0A7Y1SVG2-F1-model_v4 Formamidopyrimidine-DNA glycosylase 0.9605 1 212 GO:0003684
GO:0003906
GO:0006284
GO:0008270
GO:0016829
GO:0034039

Map