F225148

General Info

Members Datasets Scaffolds Average Seq Length
156 136 312 190

Family's Representative Sequence

Representative Sequence 3300031240|Ga0265320_10094231|Ga0265320_100942312
Length 206
Sequence MPSSNQSRNISSSESGKNLRDFLFRGLMFESEAIAFQNAGIQVGADTNQAEERLLSEALSPFSLNLRNKALEMARLYAVLHCFENEIRALIRQTLEEKDGAEWINQLPTKVKQFAEERQADAVKDSWLEGEKSDLLGFVNFGHLASIMVEKWPYFEDIIPSQHWLKQRMDELEKARNFIAHNRTLLPTEFQRIYMYIADWNRVIGL

Samples

Sample ID Description Type Environment
1 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
51 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
52 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
53 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
56 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
59 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
61 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
64 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
83 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
84 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
85 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
86 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
87 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
88 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
89 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
90 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
91 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
92 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
93 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
94 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
95 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
96 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
97 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
98 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
99 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
100 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
101 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
102 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
103 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
109 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
110 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
111 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
112 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
113 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
114 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
115 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
116 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
117 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
118 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
119 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
120 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
121 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
122 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
123 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
124 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
125 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
126 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
127 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
128 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
129 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
130 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
131 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
132 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
133 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
134 2932401849 Devosia sp. 2618 Isolate Rhizosphere
135 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
136 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.67
Metatranscriptomes 0
Isolates 8.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.36
Nodule 3.85
Rhizoplane 2.56
Rhizosphere 65.38
Stem 0
Stem Tuber 0
Unclassified 11.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265320_10094231 3300031240 Bacteria 1384
2 JGI24738J21930_10005920 3300002075 Bacteria 2903
3 JGI25152J39213_1003535 3300002773 Bacteria 5293
4 JGI25159J45721_1002133 3300002987 Bacteria 7737
5 JGI25151J46595_10009649 3300003187 Bacteria 4552
6 JGI25153J46596_10009415 3300003215 Bacteria 4544
7 rootH1_10396049 3300003323 Unclassified 1305
8 JGI25160J50197_1003847 3300003354 Bacteria 6594
9 Ga0055526_1002612 3300003771 Bacteria 12042
10 Ga0055537_1002649 3300003773 Bacteria 5856
11 Ga0055524_1002486 3300003775 Bacteria 9470
12 Ga0055534_1004587 3300003784 Bacteria 3945
13 Ga0055528_1006638 3300003790 Bacteria 5222
14 Ga0055531_10002918 3300003794 Bacteria 11128
15 Ga0065165_1010808 3300005262 Bacteria 3891
16 Ga0065714_10088163 3300005288 Bacteria 2029
17 Ga0070658_10004714 3300005327 Bacteria 11085
18 Ga0070658_10066860 3300005327 Bacteria 2936
19 Ga0070680_100311116 3300005336 Bacteria 1336
20 Ga0070661_100117827 3300005344 Bacteria 1987
21 Ga0070663_100237558 3300005455 Bacteria 1437
22 Ga0070663_100378524 3300005455 Bacteria 1152
23 Ga0070706_100149263 3300005467 Bacteria 2182
24 Ga0070707_100391594 3300005468 Unclassified 1349
25 Ga0070707_101127424 3300005468 Unclassified 750
26 Ga0070699_100139556 3300005518 Bacteria 2139
27 Ga0070697_100134028 3300005536 Bacteria 2079
28 Ga0068853_100027208 3300005539 Unclassified 4804
29 Ga0070665_101573865 3300005548 Unclassified 665
30 Ga0068855_100109300 3300005563 Bacteria 3176
31 Ga0068855_100150747 3300005563 Bacteria 2644
32 Ga0068855_100714411 3300005563 Bacteria 1071
33 Ga0068854_100000227 3300005578 Bacteria 38075
34 Ga0068856_100306729 3300005614 Bacteria 1605
35 Ga0068856_100762803 3300005614 Unclassified 987
36 Ga0068852_100218571 3300005616 Bacteria 1811
37 Ga0068852_100236845 3300005616 Bacteria 1742
38 Ga0068851_10108258 3300005834 Bacteria 1481
39 Ga0068858_100321804 3300005842 Unclassified 1478
40 Ga0068858_100582621 3300005842 Bacteria 1084
41 Ga0075368_10175627 3300006042 Bacteria 901
42 Ga0097621_100141503 3300006237 Bacteria 2056
43 Ga0075433_10020788 3300006852 Bacteria 5494
44 Ga0075434_100038166 3300006871 Plasmid 4758
45 Ga0075436_100022083 3300006914 Bacteria 4370
46 Ga0099794_10264121 3300007265 Bacteria 889
47 Ga0105240_10823285 3300009093 Bacteria 1004
48 Ga0105241_10070598 3300009174 Bacteria 2710
49 Ga0105237_10145689 3300009545 Bacteria 2363
50 Ga0105238_10691468 3300009551 Bacteria 1032
51 Ga0105239_10450890 3300010375 Bacteria 1459
52 Ga0105239_11465212 3300010375 Unclassified 789
53 Ga0157373_10004722 3300013100 Bacteria 10243
54 Ga0157373_10034462 3300013100 Bacteria 3635
55 Ga0157373_10379561 3300013100 Bacteria 1011
56 Ga0157370_10201434 3300013104 Bacteria 1846
57 Ga0157369_10166197 3300013105 Bacteria 2327
58 Ga0157369_10402846 3300013105 Bacteria 1419
59 Ga0157374_10097135 3300013296 Bacteria 2818
60 Ga0157372_10074544 3300013307 Bacteria 3827
61 Ga0157372_10222447 3300013307 Unclassified 2188
62 Ga0157372_10245967 3300013307 Bacteria 2076
63 Ga0157372_11200720 3300013307 Bacteria 876
64 Ga0157379_10330592 3300014968 Bacteria 1393
65 Ga0182005_1027348 3300015265 Unclassified 1555
66 Ga0209436_101766 3300025208 Bacteria 7097
67 Ga0209129_1004218 3300025258 Bacteria 5760
68 Ga0209565_1000984 3300025263 Bacteria 14638
69 Ga0209673_1000190 3300025273 Bacteria 123411
70 Ga0209130_1000811 3300025284 Bacteria 26434
71 Ga0209675_1008270 3300025291 Bacteria 3850
72 Ga0209676_1010038 3300025292 Bacteria 3999
73 Ga0209025_1005074 3300025294 Bacteria 10965
74 Ga0209564_1000535 3300025295 Bacteria 61415
75 Ga0209564_1001808 3300025295 Bacteria 19736
76 Ga0209758_1013014 3300025297 Bacteria 4585
77 Ga0209050_1014532 3300025298 Bacteria 3382
78 Ga0209256_1000270 3300025299 Bacteria 90996
79 Ga0207426_1000369 3300025302 Bacteria 79694
80 Ga0207426_1001421 3300025302 Bacteria 19993
81 Ga0209051_1093183 3300025303 Bacteria 831
82 Ga0209257_1000136 3300025304 Bacteria 204863
83 Ga0207656_10007340 3300025321 Unclassified 4008
84 Ga0207655_1005681 3300025728 Bacteria 8433
85 Ga0207705_10004471 3300025909 Bacteria 10563
86 Ga0207684_10181228 3300025910 Bacteria 1816
87 Ga0207654_10114772 3300025911 Bacteria 1681
88 Ga0207671_10219488 3300025914 Bacteria 1489
89 Ga0207660_10275871 3300025917 Bacteria 1333
90 Ga0207649_10229457 3300025920 Bacteria 1327
91 Ga0207646_10476376 3300025922 Unclassified 1126
92 Ga0207694_10881003 3300025924 Bacteria 757
93 Ga0207667_10078409 3300025949 Bacteria 3424
94 Ga0207667_10127586 3300025949 Bacteria 2620
95 Ga0207640_10000226 3300025981 Bacteria 39673
96 Ga0207639_10015031 3300026041 Bacteria 5451
97 Ga0207702_10009599 3300026078 Bacteria 8125
98 Ga0207698_10110139 3300026142 Unclassified 2306
99 Ga0268266_11435922 3300028379 Unclassified 665
100 Ga0307517_10161716 3300028786 Bacteria 1500
101 Ga0265324_10063673 3300029957 Bacteria 1259
102 Ga0265330_10101397 3300031235 Bacteria 1232
103 Ga0265340_10000080 3300031247 Bacteria 46799
104 Ga0265316_10062818 3300031344 Bacteria 2882
105 Ga0307509_10112623 3300031507 Bacteria 2720
106 Ga0307510_10000230 3300033180 Bacteria 50153
107 Ga0395905_0000348 3300037471 Bacteria 65915
108 Ga0439465_0000124 3300041413 Bacteria 18593
109 Ga0439451_007906 3300042009 Bacteria 2159
110 Ga0439456_000354 3300042013 Bacteria 10346
111 Ga0439456_007152 3300042013 Unclassified 2288
112 Ga0453684_0000116 3300044712 Bacteria 352304
113 Ga0453684_0004623 3300044712 Bacteria 28621
114 Ga0466960_0075466 3300044901 Unclassified 1687
115 Ga0495605_0000194 3300046474 Bacteria 76134
116 Ga0495610_0138292 3300046512 Unclassified 1051
117 Ga0495625_0017914 3300046660 Bacteria 5536
118 Ga0495669_0000014 3300046684 Bacteria 140832
119 Ga0495676_0004112 3300047321 Bacteria 13263
120 Ga0495593_0007267 3300047673 Bacteria 6485
121 Ga0496115_0000062 3300048918 Bacteria 100189
122 Ga0496126_0002166 3300048929 Bacteria 27310
123 Ga0501032_0101878 3300049569 Bacteria 1902
124 Ga0501033_0289815 3300049570 Bacteria 1154
125 Ga0501037_0411524 3300049573 Bacteria 926
126 Ga0501038_0080239 3300049574 Bacteria 2750
127 Ga0501039_0154469 3300049575 Bacteria 1803
128 Ga0501250_022289 3300049680 Bacteria 828
129 Ga0501259_016947 3300049688 Bacteria 1258
130 Ga0501280_005401 3300049776 Bacteria 1827
131 Ga0501044_0256119 3300049823 Bacteria 1689
132 nmdc:mga06z11_73301_c1 3300050494 Bacteria 1818
133 nmdc:mga04h51_147123_c1 3300050495 Bacteria 898
134 nmdc:mga0n895_14719_c1 3300050512 Bacteria 7115
135 nmdc:mga0rr50_599684_c1 3300050513 Bacteria 939
136 nmdc:mga08x19_32727_c1 3300050514 Bacteria 3279
137 nmdc:mga0a205_15710_c1 3300050515 Bacteria 7076
138 Ga0500643_036355 3300053087 Bacteria 1471
139 Ga0500644_0286766 3300053088 Unclassified 702
140 Ga0500651_0219776 3300053093 Bacteria 1115
141 Ga0500574_000036 3300053141 Bacteria 16882
142 Ga0500622_0007696 3300053156 Bacteria 6089
143 Ga0500637_0002339 3300053178 Bacteria 8401
144 2601797376 2600255318 Bacteria 6383414
145 2606075893 2603880185 Bacteria 6379190
146 2606130818 2603880199 Bacteria 6377649
147 2838738770 2838736955 Bacteria 5760694
148 2841840861 2841840854 Bacteria 5761912
149 2842140641 2842140634 Bacteria 5759631
150 2885311599 2885305155 Bacteria 7348390
151 2889037576 2889033259 Bacteria 9099371
152 2904456544 2904449895 Bacteria 6927402
153 2924759157 2924754689 Bacteria 6774424
154 2932404699 2932401849 Bacteria 4262978
155 2958460521 2958458903 Bacteria 5301041
156 8004399975 8004395343 Bacteria 6620908
157 Ga0265320_10094231
158 JGI24738J21930_10005920
159 JGI25152J39213_1003535
160 JGI25159J45721_1002133
161 JGI25151J46595_10009649
162 JGI25153J46596_10009415
163 rootH1_10396049
164 JGI25160J50197_1003847
165 Ga0055526_1002612
166 Ga0055537_1002649
167 Ga0055524_1002486
168 Ga0055534_1004587
169 Ga0055528_1006638
170 Ga0055531_10002918
171 Ga0065165_1010808
172 Ga0065714_10088163
173 Ga0070658_10004714
174 Ga0070658_10066860
175 Ga0070680_100311116
176 Ga0070661_100117827
177 Ga0070663_100237558
178 Ga0070663_100378524
179 Ga0070706_100149263
180 Ga0070707_100391594
181 Ga0070707_101127424
182 Ga0070699_100139556
183 Ga0070697_100134028
184 Ga0068853_100027208
185 Ga0070665_101573865
186 Ga0068855_100109300
187 Ga0068855_100150747
188 Ga0068855_100714411
189 Ga0068854_100000227
190 Ga0068856_100306729
191 Ga0068856_100762803
192 Ga0068852_100218571
193 Ga0068852_100236845
194 Ga0068851_10108258
195 Ga0068858_100321804
196 Ga0068858_100582621
197 Ga0075368_10175627
198 Ga0097621_100141503
199 Ga0075433_10020788
200 Ga0075434_100038166
201 Ga0075436_100022083
202 Ga0099794_10264121
203 Ga0105240_10823285
204 Ga0105241_10070598
205 Ga0105237_10145689
206 Ga0105238_10691468
207 Ga0105239_10450890
208 Ga0105239_11465212
209 Ga0157373_10004722
210 Ga0157373_10034462
211 Ga0157373_10379561
212 Ga0157370_10201434
213 Ga0157369_10166197
214 Ga0157369_10402846
215 Ga0157374_10097135
216 Ga0157372_10074544
217 Ga0157372_10222447
218 Ga0157372_10245967
219 Ga0157372_11200720
220 Ga0157379_10330592
221 Ga0182005_1027348
222 Ga0209436_101766
223 Ga0209129_1004218
224 Ga0209565_1000984
225 Ga0209673_1000190
226 Ga0209130_1000811
227 Ga0209675_1008270
228 Ga0209676_1010038
229 Ga0209025_1005074
230 Ga0209564_1000535
231 Ga0209564_1001808
232 Ga0209758_1013014
233 Ga0209050_1014532
234 Ga0209256_1000270
235 Ga0207426_1000369
236 Ga0207426_1001421
237 Ga0209051_1093183
238 Ga0209257_1000136
239 Ga0207656_10007340
240 Ga0207655_1005681
241 Ga0207705_10004471
242 Ga0207684_10181228
243 Ga0207654_10114772
244 Ga0207671_10219488
245 Ga0207660_10275871
246 Ga0207649_10229457
247 Ga0207646_10476376
248 Ga0207694_10881003
249 Ga0207667_10078409
250 Ga0207667_10127586
251 Ga0207640_10000226
252 Ga0207639_10015031
253 Ga0207702_10009599
254 Ga0207698_10110139
255 Ga0268266_11435922
256 Ga0307517_10161716
257 Ga0265324_10063673
258 Ga0265330_10101397
259 Ga0265340_10000080
260 Ga0265316_10062818
261 Ga0307509_10112623
262 Ga0307510_10000230
263 Ga0395905_0000348
264 Ga0439465_0000124
265 Ga0439451_007906
266 Ga0439456_000354
267 Ga0439456_007152
268 Ga0453684_0000116
269 Ga0453684_0004623
270 Ga0466960_0075466
271 Ga0495605_0000194
272 Ga0495610_0138292
273 Ga0495625_0017914
274 Ga0495669_0000014
275 Ga0495676_0004112
276 Ga0495593_0007267
277 Ga0496115_0000062
278 Ga0496126_0002166
279 Ga0501032_0101878
280 Ga0501033_0289815
281 Ga0501037_0411524
282 Ga0501038_0080239
283 Ga0501039_0154469
284 Ga0501250_022289
285 Ga0501259_016947
286 Ga0501280_005401
287 Ga0501044_0256119
288 nmdc:mga06z11_73301_c1
289 nmdc:mga04h51_147123_c1
290 nmdc:mga0n895_14719_c1
291 nmdc:mga0rr50_599684_c1
292 nmdc:mga08x19_32727_c1
293 nmdc:mga0a205_15710_c1
294 Ga0500643_036355
295 Ga0500644_0286766
296 Ga0500651_0219776
297 Ga0500574_000036
298 Ga0500622_0007696
299 Ga0500637_0002339
300 2601797376
301 2606075893
302 2606130818
303 2838738770
304 2841840861
305 2842140641
306 2885311599
307 2889037576
308 2904456544
309 2924759157
310 2932404699
311 2958460521
312 8004399975

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18725

HEPN_SAV2148

SAV2148-like HEPN

46

200

0.87

PF18731

HEPN_Swt1

Swt1-like HEPN

78

205

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hfi-assembly1.cif.gz_A solution nmr structure of protein yppe from bacillus subtilis. northeast structural genomics consortium target sr213 0.475 98 195
2huj-assembly1.cif.gz_A crystal structure of a protein of uknown function (np_471338.1) from listeria innocua at 1.74 a resolution 0.4488 58 196
2im8-assembly2.cif.gz_B x-ray crystal structure of protein yppe from bacillus subtilis. northeast structural genomics consortium target sr213. 0.4444 65 196
4bjn-assembly3.cif.gz_C-3 crystal structure of the flax-rust effector avrm-a 0.4245 40 197
2im8-assembly1.cif.gz_A x-ray crystal structure of protein yppe from bacillus subtilis. northeast structural genomics consortium target sr213. 0.4212 63 196
ID Description Score Start End Superfamily
2hfiA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);YppE-like 0.475 98 195 1.20.120.440
af_Q57617_94_220_1.10.8.190 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Carbon monoxide dehydrogenase alpha subunit. Chain M, domain 1 0.4376 51 195 1.10.8.190
af_Q61470_1_108_1.20.5.110 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.4334 51 196 1.20.5.110
af_Q58971_21_189_1.20.1440.20 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);LemA-like domain 0.4221 52 195 1.20.1440.20
af_Q61470_1_108_1.20.5.110 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.42 51 196 1.20.5.110
ID Description Score Start End GO Terms
AF-A0A1G1DE19-F1-model_v4 Swt1-like HEPN domain-containing protein 0.9577 63 196
AF-A0A1G2DEG6-F1-model_v4 Swt1-like HEPN domain-containing protein 0.9563 63 196
AF-A0A2N2UZ50-F1-model_v4 Swt1-like HEPN domain-containing protein 0.9537 63 197
AF-A0A6P1Y4X5-F1-model_v4 Swt1-like HEPN domain-containing protein 0.9474 51 194
AF-A0A1G1DE19-F1-model_v4 Swt1-like HEPN domain-containing protein 0.9439 63 196

Map