F224768

General Info

Members Datasets Scaffolds Average Seq Length
156 110 312 327

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10006881|Ga0105242_100068813
Length 364
Sequence VQSSGNVAEQFLYKLVPPSHLQTSSPFFKVLPWMNYFRGMTLLKVSGVSRKEKNIFTVRNVSFEQKRFQKIAIAGEAGSGKTTLLKMIAGLLQPDAGEILFEGKKVRGPNDQLIPGHAGIAYLSQHFELRNNYWIHEILSYANELGPDEAAALYKTGRIDHLLNRRTDQLSGGERQRIALTRLLIGAPRLLLLDEPFSNLDTVHKDIMKSVIDDITVQPGITCIMVSHDAPDTLPWADTILVMKDGVIIQQGKPEQVYRQPINEYCAGLFGAYNLVNAADAAVLDPAKNDSQKKLLVRPEQLHINSTGAGLAATVQNILFMGSYYTIEAFTGRQLLKIRSTGHHVTRGQHIQLSLTDSPVQYIT

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
53 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
54 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
55 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
56 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
57 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
79 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
80 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
81 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
82 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
83 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
84 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
85 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
86 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
87 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
88 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
89 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
90 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
91 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
92 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
93 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
95 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
96 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
97 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
98 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
99 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
100 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
101 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
102 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
103 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
104 2738541278 Niastella sp. CF465 Isolate Unclassified
105 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
106 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
107 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
108 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
109 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
110 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.51
Metatranscriptomes 0
Isolates 4.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.18
Nodule 0
Rhizoplane 0
Rhizosphere 73.72
Stem 0
Stem Tuber 0
Unclassified 9.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_10006881 3300009176 Bacteria 8770
2 SwRhRL2b_contig_1886170 2162886007 Bacteria 206362
3 JGI24740J21852_10008247 3300001979 Bacteria 4167
4 JGI25154J39366_1000041 3300002738 Bacteria 144221
5 JGI25153J46596_10004770 3300003215 Bacteria 7226
6 rootH2_10047351 3300003320 Bacteria 12236
7 rootH2_10168903 3300003320 Bacteria 1960
8 rootL2_10213533 3300003322 Bacteria 3264
9 rootH1_10020572 3300003323 Bacteria 27768
10 rootH1_10056652 3300003323 Bacteria 2856
11 rootH1_10224452 3300003323 Bacteria 9868
12 JGI25160J50197_1001676 3300003354 Bacteria 10812
13 JGI25160J50197_1003529 3300003354 Bacteria 6971
14 Ga0065704_10070159 3300005289 Bacteria 207348
15 Ga0068869_100002383 3300005334 Bacteria 11321
16 Ga0068869_100058364 3300005334 Bacteria 2821
17 Ga0068869_100134510 3300005334 Bacteria 1903
18 Ga0068869_100182862 3300005334 Unclassified 1644
19 Ga0070666_10000449 3300005335 Bacteria 25125
20 Ga0070666_10101989 3300005335 Bacteria 1978
21 Ga0068868_100144894 3300005338 Bacteria 1952
22 Ga0070660_100221731 3300005339 Bacteria 1537
23 Ga0070674_100204343 3300005356 Bacteria 1527
24 Ga0070667_100052518 3300005367 Bacteria 3440
25 Ga0070667_100092960 3300005367 Unclassified 2596
26 Ga0070685_10300297 3300005466 Unclassified 1082
27 Ga0070684_100065493 3300005535 Unclassified 3189
28 Ga0068853_100012908 3300005539 Bacteria 6808
29 Ga0070672_100131087 3300005543 Bacteria 2060
30 Ga0070672_100307211 3300005543 Bacteria 1345
31 Ga0068855_100005466 3300005563 Bacteria 15501
32 Ga0068857_100309423 3300005577 Unclassified 1457
33 Ga0068854_100109100 3300005578 Unclassified 2085
34 Ga0068852_100080936 3300005616 Bacteria 2881
35 Ga0068859_100000041 3300005617 Bacteria 162415
36 Ga0068859_100013864 3300005617 Bacteria 8082
37 Ga0068859_100087253 3300005617 Bacteria 3168
38 Ga0068866_10169771 3300005718 Bacteria 1279
39 Ga0068861_100014332 3300005719 Bacteria 5562
40 Ga0068870_10033252 3300005840 Bacteria 2629
41 Ga0068863_100014063 3300005841 Bacteria 7711
42 Ga0068863_100032467 3300005841 Bacteria 4977
43 Ga0068863_100105036 3300005841 Bacteria 2687
44 Ga0068858_100007210 3300005842 Bacteria 10777
45 Ga0068860_100007509 3300005843 Bacteria 10906
46 Ga0068860_100008528 3300005843 Bacteria 10212
47 Ga0068860_100246094 3300005843 Bacteria 1740
48 Ga0068862_100454304 3300005844 Bacteria 1208
49 Ga0075366_10099852 3300006195 Unclassified 1741
50 Ga0075366_10117292 3300006195 Bacteria 1603
51 Ga0068871_100263706 3300006358 Bacteria 1503
52 Ga0068865_100011853 3300006881 Bacteria 5469
53 Ga0097620_100000041 3300006931 Bacteria 162415
54 Ga0097620_100013865 3300006931 Bacteria 8082
55 Ga0097620_100087252 3300006931 Bacteria 3168
56 Ga0114129_10001760 3300009147 Bacteria 29505
57 Ga0105241_10002519 3300009174 Bacteria 13743
58 Ga0105241_10100781 3300009174 Unclassified 2295
59 Ga0105242_10363189 3300009176 Bacteria 1341
60 Ga0105237_10014679 3300009545 Bacteria 8180
61 Ga0105249_10001574 3300009553 Bacteria 20014
62 Ga0105249_10151759 3300009553 Bacteria 2231
63 Ga0105249_10359031 3300009553 Bacteria 1478
64 Ga0105239_10002476 3300010375 Bacteria 23542
65 Ga0105239_10013084 3300010375 Bacteria 9220
66 Ga0105246_10028863 3300011119 Bacteria 3648
67 Ga0157371_10181816 3300013102 Unclassified 1504
68 Ga0157374_10179935 3300013296 Unclassified 2065
69 Ga0157378_10095805 3300013297 Bacteria 2703
70 Ga0163162_10003524 3300013306 Bacteria 14974
71 Ga0163162_10087674 3300013306 Unclassified 3191
72 Ga0157372_10533147 3300013307 Bacteria 1368
73 Ga0157372_10677206 3300013307 Bacteria 1201
74 Ga0157375_10064784 3300013308 Bacteria 3640
75 Ga0157375_10196008 3300013308 Unclassified 2175
76 Ga0157380_10003975 3300014326 Bacteria 10204
77 Ga0157380_10021019 3300014326 Bacteria 4890
78 Ga0157379_10047007 3300014968 Bacteria 3850
79 Ga0157376_10012488 3300014969 Bacteria 6306
80 Ga0209436_109126 3300025208 Bacteria 1915
81 Ga0209646_1000122 3300025246 Bacteria 144486
82 Ga0209646_1004018 3300025246 Bacteria 2761
83 Ga0209026_1000631 3300025250 Bacteria 22097
84 Ga0209758_1006267 3300025297 Bacteria 8658
85 Ga0207426_1000234 3300025302 Bacteria 126926
86 Ga0207426_1000530 3300025302 Bacteria 55033
87 Ga0207680_10000029 3300025903 Bacteria 78814
88 Ga0207645_10003073 3300025907 Bacteria 12814
89 Ga0207654_10116452 3300025911 Bacteria 1671
90 Ga0207671_10020693 3300025914 Bacteria 5005
91 Ga0207681_10012589 3300025923 Bacteria 5224
92 Ga0207650_10218513 3300025925 Bacteria 1533
93 Ga0207644_10229098 3300025931 Bacteria 1476
94 Ga0207706_10214966 3300025933 Bacteria 1684
95 Ga0207691_10011702 3300025940 Bacteria 8425
96 Ga0207691_10098526 3300025940 Bacteria 2611
97 Ga0207691_10303098 3300025940 Unclassified 1372
98 Ga0207689_10004245 3300025942 Bacteria 13034
99 Ga0207689_10006919 3300025942 Bacteria 9976
100 Ga0207689_10016904 3300025942 Bacteria 6173
101 Ga0207667_10059455 3300025949 Bacteria 4003
102 Ga0207651_10059786 3300025960 Bacteria 2642
103 Ga0207712_10083072 3300025961 Bacteria 2337
104 Ga0207712_10247381 3300025961 Bacteria 1439
105 Ga0207668_10150277 3300025972 Bacteria 1802
106 Ga0207658_10166879 3300025986 Bacteria 1809
107 Ga0207658_10310487 3300025986 Unclassified 1362
108 Ga0207703_10002849 3300026035 Bacteria 14742
109 Ga0207641_10000044 3300026088 Bacteria 183824
110 Ga0207641_10103734 3300026088 Bacteria 2509
111 Ga0207641_10136228 3300026088 Bacteria 2210
112 Ga0207648_10408993 3300026089 Bacteria 1230
113 Ga0207674_10080004 3300026116 Bacteria 3272
114 Ga0207674_10095286 3300026116 Bacteria 2962
115 Ga0207674_10337006 3300026116 Unclassified 1458
116 Ga0207675_100051984 3300026118 Bacteria 3824
117 Ga0207683_10179229 3300026121 Bacteria 1921
118 Ga0307515_10001521 3300028794 Bacteria 51888
119 Ga0307511_10000046 3300030521 Bacteria 100284
120 Ga0265327_10000551 3300031251 Bacteria 64082
121 Ga0307513_10043502 3300031456 Bacteria 4931
122 Ga0307513_10158761 3300031456 Bacteria 2156
123 Ga0307509_10015731 3300031507 Bacteria 8807
124 Ga0307508_10001453 3300031616 Bacteria 26619
125 Ga0307516_10000111 3300031730 Bacteria 94707
126 Ga0439457_010233 3300042014 Bacteria 2163
127 Ga0450898_009979 3300042134 Bacteria 1530
128 Ga0466969_0000045 3300044656 Bacteria 64246
129 Ga0466972_0000464 3300044658 Bacteria 20631
130 Ga0466966_0000446 3300044684 Bacteria 26590
131 Ga0466957_0001372 3300044842 Bacteria 12717
132 Ga0466957_0012597 3300044842 Bacteria 4896
133 Ga0466959_0000062 3300045049 Bacteria 75615
134 Ga0466959_0174228 3300045049 Bacteria 1508
135 Ga0495686_0000700 3300047472 Bacteria 45275
136 Ga0501047_0006115 3300049581 Bacteria 11312
137 Ga0501047_0020249 3300049581 Bacteria 6388
138 Ga0501044_0008129 3300049823 Bacteria 11513
139 nmdc:mga0k408_95298_c1 3300050493 Bacteria 1751
140 nmdc:mga05p37_1961_c1 3300050507 Bacteria 23994
141 Ga0500578_0000042 3300053086 Bacteria 129410
142 Ga0500583_0000134 3300053092 Bacteria 32670
143 Ga0500583_0000815 3300053092 Bacteria 8970
144 Ga0500652_069007 3300053131 Bacteria 1462
145 Ga0500589_060591 3300053147 Bacteria 1735
146 Ga0500616_0003469 3300053153 Bacteria 12019
147 Ga0500622_0090728 3300053156 Bacteria 1516
148 Ga0500611_000059 3300053727 Bacteria 48867
149 Ga0500611_012518 3300053727 Bacteria 1434
150 2738730875 2738541278 Bacteria 9755573
151 2819679973 2818991460 Bacteria 7595395
152 2929179922 2929177148 Bacteria 7883697
153 2929925321 2929921140 Bacteria 8649150
154 2945982343 2945977869 Bacteria 7777518
155 2946018270 2946013367 Bacteria 7766675
156 8003154186 8003151029 Bacteria 8187759
157 Ga0105242_10006881
158 SwRhRL2b_contig_1886170
159 JGI24740J21852_10008247
160 JGI25154J39366_1000041
161 JGI25153J46596_10004770
162 rootH2_10047351
163 rootH2_10168903
164 rootL2_10213533
165 rootH1_10020572
166 rootH1_10056652
167 rootH1_10224452
168 JGI25160J50197_1001676
169 JGI25160J50197_1003529
170 Ga0065704_10070159
171 Ga0068869_100002383
172 Ga0068869_100058364
173 Ga0068869_100134510
174 Ga0068869_100182862
175 Ga0070666_10000449
176 Ga0070666_10101989
177 Ga0068868_100144894
178 Ga0070660_100221731
179 Ga0070674_100204343
180 Ga0070667_100052518
181 Ga0070667_100092960
182 Ga0070685_10300297
183 Ga0070684_100065493
184 Ga0068853_100012908
185 Ga0070672_100131087
186 Ga0070672_100307211
187 Ga0068855_100005466
188 Ga0068857_100309423
189 Ga0068854_100109100
190 Ga0068852_100080936
191 Ga0068859_100000041
192 Ga0068859_100013864
193 Ga0068859_100087253
194 Ga0068866_10169771
195 Ga0068861_100014332
196 Ga0068870_10033252
197 Ga0068863_100014063
198 Ga0068863_100032467
199 Ga0068863_100105036
200 Ga0068858_100007210
201 Ga0068860_100007509
202 Ga0068860_100008528
203 Ga0068860_100246094
204 Ga0068862_100454304
205 Ga0075366_10099852
206 Ga0075366_10117292
207 Ga0068871_100263706
208 Ga0068865_100011853
209 Ga0097620_100000041
210 Ga0097620_100013865
211 Ga0097620_100087252
212 Ga0114129_10001760
213 Ga0105241_10002519
214 Ga0105241_10100781
215 Ga0105242_10363189
216 Ga0105237_10014679
217 Ga0105249_10001574
218 Ga0105249_10151759
219 Ga0105249_10359031
220 Ga0105239_10002476
221 Ga0105239_10013084
222 Ga0105246_10028863
223 Ga0157371_10181816
224 Ga0157374_10179935
225 Ga0157378_10095805
226 Ga0163162_10003524
227 Ga0163162_10087674
228 Ga0157372_10533147
229 Ga0157372_10677206
230 Ga0157375_10064784
231 Ga0157375_10196008
232 Ga0157380_10003975
233 Ga0157380_10021019
234 Ga0157379_10047007
235 Ga0157376_10012488
236 Ga0209436_109126
237 Ga0209646_1000122
238 Ga0209646_1004018
239 Ga0209026_1000631
240 Ga0209758_1006267
241 Ga0207426_1000234
242 Ga0207426_1000530
243 Ga0207680_10000029
244 Ga0207645_10003073
245 Ga0207654_10116452
246 Ga0207671_10020693
247 Ga0207681_10012589
248 Ga0207650_10218513
249 Ga0207644_10229098
250 Ga0207706_10214966
251 Ga0207691_10011702
252 Ga0207691_10098526
253 Ga0207691_10303098
254 Ga0207689_10004245
255 Ga0207689_10006919
256 Ga0207689_10016904
257 Ga0207667_10059455
258 Ga0207651_10059786
259 Ga0207712_10083072
260 Ga0207712_10247381
261 Ga0207668_10150277
262 Ga0207658_10166879
263 Ga0207658_10310487
264 Ga0207703_10002849
265 Ga0207641_10000044
266 Ga0207641_10103734
267 Ga0207641_10136228
268 Ga0207648_10408993
269 Ga0207674_10080004
270 Ga0207674_10095286
271 Ga0207674_10337006
272 Ga0207675_100051984
273 Ga0207683_10179229
274 Ga0307515_10001521
275 Ga0307511_10000046
276 Ga0265327_10000551
277 Ga0307513_10043502
278 Ga0307513_10158761
279 Ga0307509_10015731
280 Ga0307508_10001453
281 Ga0307516_10000111
282 Ga0439457_010233
283 Ga0450898_009979
284 Ga0466969_0000045
285 Ga0466972_0000464
286 Ga0466966_0000446
287 Ga0466957_0001372
288 Ga0466957_0012597
289 Ga0466959_0000062
290 Ga0466959_0174228
291 Ga0495686_0000700
292 Ga0501047_0006115
293 Ga0501047_0020249
294 Ga0501044_0008129
295 nmdc:mga0k408_95298_c1
296 nmdc:mga05p37_1961_c1
297 Ga0500578_0000042
298 Ga0500583_0000134
299 Ga0500583_0000815
300 Ga0500652_069007
301 Ga0500589_060591
302 Ga0500616_0003469
303 Ga0500622_0090728
304 Ga0500611_000059
305 Ga0500611_012518
306 2738730875
307 2819679973
308 2929179922
309 2929925321
310 2945982343
311 2946018270
312 8003154186

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

58

198

0.91

PF08402

TOBE_2

TOBE domain

295

361

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yer-assembly1.cif.gz_B crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9087 2 215
1fr3-assembly1.cif.gz_A the high resolution structure of a molybdate binding protein from sporomusa ovata 0.9059 271 317
7d9j-assembly1.cif.gz_A spdh spermidine dehydrogenase y443a mutant 0.9004 272 300
7d9h-assembly1.cif.gz_A spdh spermidine dehydrogenase n33 truncation structure 0.8975 272 300
4x4j-assembly1.cif.gz_B-2 structural and functional studies of bexe: insights into oxidation during be-7585a biosynthesis 0.8921 272 299
ID Description Score Start End Superfamily
af_P9WNF9_1_152_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9249 272 300 3.50.50.60
af_Q2G2A7_273_342_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9116 256 322 2.40.50.140
1fr3A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9059 271 317 2.40.50.100
af_Q9XW49_1237_1482_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9045 2 215 3.40.50.300
af_P33360_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9012 1 229 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A841EMK5-F1-model_v4 Iron(III) transport system ATP-binding protein 0.922 1 228 GO:0005524
GO:0016887
AF-A0A2H6F2F2-F1-model_v4 Sulfate/thiosulfate import ATP-binding protein CysA (EC 3.6.3.25) 0.9121 1 228 GO:0005524
GO:0005886
GO:0015408
GO:0016887
AF-A0A380JYJ4-F1-model_v4 ABC transporter ATP-binding protein (EC 3.6.3.-) 0.9103 1 216 GO:0005524
GO:0016887
AF-A0A525HML0-F1-model_v4 ATP-binding cassette domain-containing protein 0.9089 1 202 GO:0005524
GO:0016887
AF-A0A519QDZ9-F1-model_v4 ABC transporter ATP-binding protein 0.9088 2 196 GO:0005524
GO:0016887

Map