F224320

General Info

Members Datasets Scaffolds Average Seq Length
156 124 312 139

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100574290|Ga0070699_1005742902
Length 160
Sequence VPSFVRPSPTRSAALPVDAPKTMKKRVLILCTGNSARSQMAEGLLKHDAGDRFEVESAGTKPGHVRPEAIAVMKELGIDISGHRSKHVGEFQGQSFDYVLTVCDNAKESCPVFPGHAKRLHNAFEDPAALQGTEEERLALFRRVRNELRDYLKTFPANAG

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
62 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
63 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
64 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
94 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
97 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
100 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
101 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
102 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
103 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
104 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
106 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
107 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
108 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
109 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
110 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
111 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
112 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
113 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
114 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
115 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
116 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
117 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
118 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
119 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
120 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
122 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
123 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
124 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.28
Rhizosphere 94.87
Stem 0
Stem Tuber 0
Unclassified 14.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100574290 3300005518 Bacteria 1027
2 Ga0065704_10091102 3300005289 Bacteria 2740
3 Ga0070658_10209610 3300005327 Bacteria 1646
4 Ga0070658_10474102 3300005327 Unclassified 1080
5 Ga0070676_10052631 3300005328 Bacteria 2395
6 Ga0070683_100090693 3300005329 Bacteria 2869
7 Ga0070690_100665669 3300005330 Bacteria 796
8 Ga0070682_101163685 3300005337 Unclassified 649
9 Ga0068868_100063639 3300005338 Bacteria 2926
10 Ga0070689_102035111 3300005340 Bacteria 525
11 Ga0070687_100047728 3300005343 Bacteria 2198
12 Ga0070669_100073129 3300005353 Bacteria 2539
13 Ga0070671_100517774 3300005355 Bacteria 1027
14 Ga0070673_100132093 3300005364 Bacteria 2096
15 Ga0070659_100085740 3300005366 Bacteria 2519
16 Ga0070713_100954588 3300005436 Bacteria 826
17 Ga0070678_100077469 3300005456 Bacteria 2508
18 Ga0070681_10595659 3300005458 Bacteria 1020
19 Ga0070681_11377491 3300005458 Bacteria 629
20 Ga0068867_100293252 3300005459 Bacteria 1338
21 Ga0068867_100480607 3300005459 Bacteria 1064
22 Ga0070707_102008732 3300005468 Unclassified 546
23 Ga0070698_100026583 3300005471 Bacteria 6024
24 Ga0070699_100028021 3300005518 Bacteria 4858
25 Ga0070679_101088577 3300005530 Bacteria 744
26 Ga0068853_100294473 3300005539 Bacteria 1499
27 Ga0070686_100012905 3300005544 Bacteria 4771
28 Ga0070696_100148251 3300005546 Bacteria 1720
29 Ga0070693_100030957 3300005547 Bacteria 2930
30 Ga0070665_101147546 3300005548 Bacteria 788
31 Ga0070704_100424176 3300005549 Bacteria 1140
32 Ga0068855_100036104 3300005563 Bacteria 5884
33 Ga0070664_100472767 3300005564 Bacteria 1153
34 Ga0068857_100709775 3300005577 Bacteria 956
35 Ga0068854_101108937 3300005578 Bacteria 705
36 Ga0068856_100050606 3300005614 Bacteria 4096
37 Ga0068852_100503783 3300005616 Bacteria 1206
38 Ga0068859_100772250 3300005617 Bacteria 1049
39 Ga0068864_100141751 3300005618 Bacteria 2169
40 Ga0068861_101550160 3300005719 Bacteria 651
41 Ga0068858_100102915 3300005842 Bacteria 2664
42 Ga0068860_100024211 3300005843 Bacteria 5870
43 Ga0068860_100681966 3300005843 Bacteria 1037
44 Ga0068860_101589891 3300005843 Unclassified 676
45 Ga0081539_10088774 3300005985 Bacteria 1602
46 Ga0070717_10013644 3300006028 Bacteria 6234
47 Ga0070717_10512009 3300006028 Bacteria 1085
48 Ga0070717_11067917 3300006028 Bacteria 735
49 Ga0097621_100139885 3300006237 Bacteria 2068
50 Ga0068871_100264662 3300006358 Bacteria 1501
51 Ga0068865_100164228 3300006881 Bacteria 1696
52 Ga0068865_100233463 3300006881 Bacteria 1444
53 Ga0075436_100063015 3300006914 Unclassified 2563
54 Ga0097620_100772202 3300006931 Bacteria 1049
55 Ga0105245_10024981 3300009098 Bacteria 5251
56 Ga0105247_10451976 3300009101 Bacteria 926
57 Ga0105243_10503608 3300009148 Bacteria 1148
58 Ga0105243_10606473 3300009148 Unclassified 1055
59 Ga0105241_10010673 3300009174 Bacteria 6738
60 Ga0105242_10012668 3300009176 Bacteria 6494
61 Ga0105242_12314854 3300009176 Unclassified 584
62 Ga0105248_10008653 3300009177 Bacteria 11181
63 Ga0105248_10151400 3300009177 Bacteria 2617
64 Ga0105248_11027654 3300009177 Unclassified 931
65 Ga0105238_10029444 3300009551 Bacteria 5594
66 Ga0105249_11408447 3300009553 Bacteria 769
67 Ga0157371_11523588 3300013102 Bacteria 522
68 Ga0157370_10617326 3300013104 Bacteria 992
69 Ga0157378_10102605 3300013297 Bacteria 2613
70 Ga0163162_10331196 3300013306 Bacteria 1655
71 Ga0163162_12069829 3300013306 Unclassified 653
72 Ga0157372_10003294 3300013307 Bacteria 17440
73 Ga0163163_10222897 3300014325 Bacteria 1934
74 Ga0163163_11044253 3300014325 Bacteria 880
75 Ga0157376_10124947 3300014969 Unclassified 2286
76 Ga0213872_10043343 3300021361 Bacteria 2051
77 Ga0213875_10035273 3300021388 Bacteria 2360
78 Ga0228598_1008702 3300024227 Bacteria 2043
79 Ga0207642_10155838 3300025899 Unclassified 1221
80 Ga0207710_10002018 3300025900 Bacteria 9672
81 Ga0207705_10395113 3300025909 Bacteria 1069
82 Ga0207705_10942355 3300025909 Unclassified 668
83 Ga0207684_10354358 3300025910 Bacteria 1263
84 Ga0207654_10165451 3300025911 Bacteria 1432
85 Ga0207693_10319435 3300025915 Bacteria 1215
86 Ga0207663_10783141 3300025916 Unclassified 759
87 Ga0207663_11661525 3300025916 Unclassified 514
88 Ga0207652_10398750 3300025921 Bacteria 1241
89 Ga0207687_10207087 3300025927 Bacteria 1537
90 Ga0207700_11612534 3300025928 Bacteria 574
91 Ga0207664_10304928 3300025929 Bacteria 1402
92 Ga0207690_10054071 3300025932 Bacteria 2697
93 Ga0207686_10037363 3300025934 Bacteria 2930
94 Ga0207686_10101368 3300025934 Bacteria 1923
95 Ga0207709_10517663 3300025935 Bacteria 933
96 Ga0207709_10662068 3300025935 Bacteria 832
97 Ga0207665_10502656 3300025939 Unclassified 937
98 Ga0207711_10007832 3300025941 Bacteria 8930
99 Ga0207711_10081443 3300025941 Bacteria 2829
100 Ga0207661_10461488 3300025944 Unclassified 1158
101 Ga0207679_10724340 3300025945 Bacteria 904
102 Ga0207712_10149862 3300025961 Bacteria 1801
103 Ga0207712_10902593 3300025961 Bacteria 781
104 Ga0207640_10097635 3300025981 Bacteria 2051
105 Ga0207677_10208433 3300026023 Bacteria 1559
106 Ga0207702_10033339 3300026078 Bacteria 4301
107 Ga0207641_10441636 3300026088 Bacteria 1256
108 Ga0207648_10041015 3300026089 Bacteria 4066
109 Ga0207648_10531331 3300026089 Bacteria 1079
110 Ga0207674_10395796 3300026116 Bacteria 1335
111 Ga0207675_100180756 3300026118 Bacteria 2020
112 Ga0207675_100184093 3300026118 Bacteria 2001
113 Ga0207698_10170451 3300026142 Bacteria 1916
114 Ga0268265_10047723 3300028380 Bacteria 3210
115 Ga0268264_10007273 3300028381 Bacteria 9267
116 Ga0268264_10202527 3300028381 Bacteria 1817
117 Ga0268264_10515387 3300028381 Bacteria 1168
118 Ga0265319_1063246 3300028563 Bacteria 1197
119 Ga0265323_10024081 3300028653 Bacteria 2317
120 Ga0265338_10077329 3300028800 Bacteria 2814
121 Ga0265316_10814153 3300031344 Bacteria 655
122 Ga0307406_10220747 3300031901 Bacteria 1409
123 Ga0307409_100108041 3300031995 Bacteria 2326
124 Ga0307415_100450264 3300032126 Bacteria 1113
125 Ga0307415_101227847 3300032126 Bacteria 707
126 Ga0373945_0579616 3300035116 Bacteria 505
127 Ga0373946_0082776 3300035171 Bacteria 1408
128 Ga0373955_0209871 3300035172 Bacteria 1161
129 Ga0373933_0230490 3300035724 Unclassified 1190
130 Ga0373937_0120331 3300036401 Bacteria 2447
131 Ga0436364_0498979 3300037853 Bacteria 13596
132 Ga0436365_1445641 3300039437 Bacteria 2983
133 Ga0436365_1655088 3300039437 Bacteria 2892
134 Ga0436360_0237162 3300039438 Bacteria 1571
135 Ga0436361_0620644 3300039447 Bacteria 1855
136 Ga0436361_1032110 3300039447 Bacteria 6191
137 Ga0436363_0266897 3300039450 Bacteria 1412
138 Ga0436363_1171236 3300039450 Unclassified 617
139 Ga0439453_0188561 3300041408 Unclassified 506
140 Ga0495628_0121643 3300046516 Bacteria 2002
141 Ga0495628_0648085 3300046516 Bacteria 750
142 Ga0495628_0879267 3300046516 Bacteria 623
143 Ga0495652_0132420 3300046529 Bacteria 1972
144 Ga0495665_0178984 3300046531 Bacteria 1102
145 Ga0495667_0141573 3300046559 Bacteria 1550
146 Ga0495604_0724289 3300047317 Unclassified 630
147 Ga0495674_0028727 3300047319 Bacteria 5067
148 Ga0495674_0409510 3300047319 Bacteria 1094
149 Ga0495602_0228700 3300048088 Unclassified 1399
150 Ga0496102_1521543 3300048905 Unclassified 588
151 Ga0496112_0187907 3300048915 Bacteria 2029
152 Ga0501047_0376652 3300049581 Bacteria 1254
153 Ga0501081_0314684 3300049743 Bacteria 1150
154 Ga0501044_0714873 3300049823 Bacteria 886
155 nmdc:mga05p37_1657014_c1 3300050507 Bacteria 626
156 nmdc:mga08x19_184397_c1 3300050514 Unclassified 1426
157 Ga0070699_100574290
158 Ga0065704_10091102
159 Ga0070658_10209610
160 Ga0070658_10474102
161 Ga0070676_10052631
162 Ga0070683_100090693
163 Ga0070690_100665669
164 Ga0070682_101163685
165 Ga0068868_100063639
166 Ga0070689_102035111
167 Ga0070687_100047728
168 Ga0070669_100073129
169 Ga0070671_100517774
170 Ga0070673_100132093
171 Ga0070659_100085740
172 Ga0070713_100954588
173 Ga0070678_100077469
174 Ga0070681_10595659
175 Ga0070681_11377491
176 Ga0068867_100293252
177 Ga0068867_100480607
178 Ga0070707_102008732
179 Ga0070698_100026583
180 Ga0070699_100028021
181 Ga0070679_101088577
182 Ga0068853_100294473
183 Ga0070686_100012905
184 Ga0070696_100148251
185 Ga0070693_100030957
186 Ga0070665_101147546
187 Ga0070704_100424176
188 Ga0068855_100036104
189 Ga0070664_100472767
190 Ga0068857_100709775
191 Ga0068854_101108937
192 Ga0068856_100050606
193 Ga0068852_100503783
194 Ga0068859_100772250
195 Ga0068864_100141751
196 Ga0068861_101550160
197 Ga0068858_100102915
198 Ga0068860_100024211
199 Ga0068860_100681966
200 Ga0068860_101589891
201 Ga0081539_10088774
202 Ga0070717_10013644
203 Ga0070717_10512009
204 Ga0070717_11067917
205 Ga0097621_100139885
206 Ga0068871_100264662
207 Ga0068865_100164228
208 Ga0068865_100233463
209 Ga0075436_100063015
210 Ga0097620_100772202
211 Ga0105245_10024981
212 Ga0105247_10451976
213 Ga0105243_10503608
214 Ga0105243_10606473
215 Ga0105241_10010673
216 Ga0105242_10012668
217 Ga0105242_12314854
218 Ga0105248_10008653
219 Ga0105248_10151400
220 Ga0105248_11027654
221 Ga0105238_10029444
222 Ga0105249_11408447
223 Ga0157371_11523588
224 Ga0157370_10617326
225 Ga0157378_10102605
226 Ga0163162_10331196
227 Ga0163162_12069829
228 Ga0157372_10003294
229 Ga0163163_10222897
230 Ga0163163_11044253
231 Ga0157376_10124947
232 Ga0213872_10043343
233 Ga0213875_10035273
234 Ga0228598_1008702
235 Ga0207642_10155838
236 Ga0207710_10002018
237 Ga0207705_10395113
238 Ga0207705_10942355
239 Ga0207684_10354358
240 Ga0207654_10165451
241 Ga0207693_10319435
242 Ga0207663_10783141
243 Ga0207663_11661525
244 Ga0207652_10398750
245 Ga0207687_10207087
246 Ga0207700_11612534
247 Ga0207664_10304928
248 Ga0207690_10054071
249 Ga0207686_10037363
250 Ga0207686_10101368
251 Ga0207709_10517663
252 Ga0207709_10662068
253 Ga0207665_10502656
254 Ga0207711_10007832
255 Ga0207711_10081443
256 Ga0207661_10461488
257 Ga0207679_10724340
258 Ga0207712_10149862
259 Ga0207712_10902593
260 Ga0207640_10097635
261 Ga0207677_10208433
262 Ga0207702_10033339
263 Ga0207641_10441636
264 Ga0207648_10041015
265 Ga0207648_10531331
266 Ga0207674_10395796
267 Ga0207675_100180756
268 Ga0207675_100184093
269 Ga0207698_10170451
270 Ga0268265_10047723
271 Ga0268264_10007273
272 Ga0268264_10202527
273 Ga0268264_10515387
274 Ga0265319_1063246
275 Ga0265323_10024081
276 Ga0265338_10077329
277 Ga0265316_10814153
278 Ga0307406_10220747
279 Ga0307409_100108041
280 Ga0307415_100450264
281 Ga0307415_101227847
282 Ga0373945_0579616
283 Ga0373946_0082776
284 Ga0373955_0209871
285 Ga0373933_0230490
286 Ga0373937_0120331
287 Ga0436364_0498979
288 Ga0436365_1445641
289 Ga0436365_1655088
290 Ga0436360_0237162
291 Ga0436361_0620644
292 Ga0436361_1032110
293 Ga0436363_0266897
294 Ga0436363_1171236
295 Ga0439453_0188561
296 Ga0495628_0121643
297 Ga0495628_0648085
298 Ga0495628_0879267
299 Ga0495652_0132420
300 Ga0495665_0178984
301 Ga0495667_0141573
302 Ga0495604_0724289
303 Ga0495674_0028727
304 Ga0495674_0409510
305 Ga0495602_0228700
306 Ga0496102_1521543
307 Ga0496112_0187907
308 Ga0501047_0376652
309 Ga0501081_0314684
310 Ga0501044_0714873
311 nmdc:mga05p37_1657014_c1
312 nmdc:mga08x19_184397_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01451

LMWPc

Low molecular weight phosphotyrosine protein phosphatase

27

155

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p6m-assembly1.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus 0.9555 5 135
8p6m-assembly1.cif.gz_A arsenate reductase (arsc2) from deinococcus indicus 0.9462 5 135
1rxi-assembly1.cif.gz_A pi258 arsenate reductase (arsc) triple mutant c10s/c15a/c82s 0.9349 2 135
2fxi-assembly1.cif.gz_A arsenate reductase (arsc from pi258) c10s/c15a double mutant with sulfate in its active site 0.9245 2 135
2cd7-assembly1.cif.gz_A staphylococcus aureus pi258 arsenate reductase (arsc) h62q mutant 0.9225 2 135
ID Description Score Start End Superfamily
1jl3B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9314 4 135 3.40.50.2300
1jl3B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8987 4 135 3.40.50.2300
1jl3C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8884 5 135 3.40.50.2300
af_I6X4W4_364_495_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8816 4 135 3.40.50.2300
2myuA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8607 5 134 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A0P8A9H9-F1-model_v4 Arsenate reductase 0.9967 21 136 GO:0046685
AF-A0A2V9M334-F1-model_v4 Protein-tyrosine-phosphatase 0.9895 23 135 GO:0046685
AF-A0A523X6K7-F1-model_v4 Arsenate reductase ArsC 0.9874 4 136 GO:0046685
AF-A0A7V9FAS3-F1-model_v4 Arsenate reductase ArsC 0.9869 43 134 GO:0046685
AF-X0W164-F1-model_v4 Phosphotyrosine protein phosphatase I domain-containing protein 0.9851 2 135 GO:0046685

Map