F224067

General Info

Members Datasets Scaffolds Average Seq Length
156 103 312 246

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_100246339|Ga0070660_1002463391
Length 272
Sequence VGDAPRASPEGFQGVPAFDEPMRDQIVEHLKFAAELGVAGVSTDPAWRTRVQQATGSAETNSPGEPVASEPVRFVTRETLADIKADISDDCRRCKLHTLGRKQVVFGVGNPDADLMFVGEAPGADEDEQGVPFVGRAGQLLTKIIEAIGLTRDDVYIANVIKCRPPQNRNPEPDEVDTCEPFLFRQIDTIKPKVIVALGTFAARALLRTLDPISRLRGRVYDYRGAKLIPTFHPAYLLRNPASKRDVWEDMKVVRGLLQPSDSSLQAPDQSS

Samples

Sample ID Description Type Environment
1 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
69 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
70 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
71 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
72 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
73 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
74 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
75 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
76 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
77 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
78 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
79 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
80 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
84 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
86 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
87 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
88 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
89 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
90 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
91 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
92 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
93 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
94 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
95 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
96 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
97 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
98 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
99 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
100 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
101 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
102 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
103 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.41
Rhizosphere 93.59
Stem 0
Stem Tuber 0
Unclassified 3.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070660_100246339 3300005339 Bacteria 1456
2 Ga0065715_10241350 3300005293 Unclassified 1198
3 Ga0070676_10174410 3300005328 Bacteria 1393
4 Ga0070690_100031503 3300005330 Bacteria 3304
5 Ga0070670_100086730 3300005331 Bacteria 2690
6 Ga0070670_100289109 3300005331 Bacteria 1432
7 Ga0070666_10214126 3300005335 Bacteria 1358
8 Ga0070661_100157625 3300005344 Bacteria 1718
9 Ga0070669_100171286 3300005353 Bacteria 1693
10 Ga0070671_100095836 3300005355 Bacteria 2488
11 Ga0070708_100039987 3300005445 Bacteria 4106
12 Ga0070708_100062773 3300005445 Bacteria 3324
13 Ga0070663_100245539 3300005455 Bacteria 1415
14 Ga0070678_100079712 3300005456 Bacteria 2478
15 Ga0070662_100446668 3300005457 Bacteria 1073
16 Ga0070681_10229882 3300005458 Bacteria 1769
17 Ga0070706_100721580 3300005467 Bacteria 924
18 Ga0070698_100436302 3300005471 Bacteria 1245
19 Ga0070699_100010613 3300005518 Bacteria 7973
20 Ga0070699_100207165 3300005518 Bacteria 1745
21 Ga0070679_100416274 3300005530 Bacteria 1289
22 Ga0070686_100000572 3300005544 Bacteria 21929
23 Ga0070695_100631490 3300005545 Bacteria 844
24 Ga0070665_100225183 3300005548 Bacteria 1876
25 Ga0070665_100707285 3300005548 Bacteria 1021
26 Ga0070704_100236514 3300005549 Bacteria 1493
27 Ga0068855_100116988 3300005563 Bacteria 3055
28 Ga0068854_100157525 3300005578 Bacteria 1756
29 Ga0068859_100214039 3300005617 Bacteria 2014
30 Ga0068859_100652803 3300005617 Bacteria 1144
31 Ga0068864_100181270 3300005618 Bacteria 1926
32 Ga0068861_100021144 3300005719 Bacteria 4676
33 Ga0068860_101063155 3300005843 Bacteria 828
34 Ga0081455_10295283 3300005937 Bacteria 1165
35 Ga0068871_100686230 3300006358 Bacteria 937
36 Ga0075430_100130400 3300006846 Bacteria 2095
37 Ga0075431_100156684 3300006847 Bacteria 2343
38 Ga0075433_10011258 3300006852 Bacteria 7201
39 Ga0075433_10045183 3300006852 Bacteria 3828
40 Ga0075433_10293478 3300006852 Bacteria 1440
41 Ga0075434_100013055 3300006871 Bacteria 7888
42 Ga0075434_100020443 3300006871 Bacteria 6423
43 Ga0075434_100089533 3300006871 Bacteria 3079
44 Ga0075434_100192353 3300006871 Bacteria 2061
45 Ga0075429_100175095 3300006880 Bacteria 1880
46 Ga0075429_100214034 3300006880 Bacteria 1688
47 Ga0075429_100712756 3300006880 Bacteria 879
48 Ga0075436_100019234 3300006914 Bacteria 4679
49 Ga0097620_100214039 3300006931 Bacteria 2014
50 Ga0097620_100652752 3300006931 Bacteria 1144
51 Ga0075435_100000546 3300007076 Bacteria 23091
52 Ga0075435_100000822 3300007076 Bacteria 19336
53 Ga0105240_10269931 3300009093 Bacteria 1959
54 Ga0105240_10287097 3300009093 Bacteria 1888
55 Ga0114129_10001166 3300009147 Bacteria 34847
56 Ga0114129_10001945 3300009147 Bacteria 28294
57 Ga0114129_10008216 3300009147 Bacteria 14882
58 Ga0114129_10043832 3300009147 Bacteria 6295
59 Ga0114129_10114406 3300009147 Bacteria 3720
60 Ga0114129_10255813 3300009147 Bacteria 2349
61 Ga0114129_10781026 3300009147 Bacteria 1220
62 Ga0105241_10082561 3300009174 Bacteria 2519
63 Ga0105248_10021862 3300009177 Bacteria 7088
64 Ga0105248_10215294 3300009177 Bacteria 2164
65 Ga0105238_10127203 3300009551 Bacteria 2526
66 Ga0105249_10004760 3300009553 Bacteria 11709
67 Ga0157378_10002303 3300013297 Bacteria 16971
68 Ga0157376_10564810 3300014969 Unclassified 1128
69 Ga0207680_10092016 3300025903 Bacteria 1931
70 Ga0207684_10609762 3300025910 Bacteria 932
71 Ga0207707_10155071 3300025912 Bacteria 2003
72 Ga0207695_10082025 3300025913 Bacteria 3262
73 Ga0207695_10445953 3300025913 Bacteria 1177
74 Ga0207662_10024343 3300025918 Bacteria 3484
75 Ga0207657_10211435 3300025919 Bacteria 1557
76 Ga0207646_10423552 3300025922 Bacteria 1202
77 Ga0207650_10262336 3300025925 Bacteria 1402
78 Ga0207644_10071053 3300025931 Bacteria 2546
79 Ga0207706_10093569 3300025933 Bacteria 2643
80 Ga0207704_10094609 3300025938 Bacteria 1973
81 Ga0207711_10036691 3300025941 Bacteria 4160
82 Ga0207711_10096273 3300025941 Bacteria 2612
83 Ga0207711_10608242 3300025941 Bacteria 1020
84 Ga0207711_10666736 3300025941 Bacteria 970
85 Ga0207651_10017455 3300025960 Bacteria 4243
86 Ga0207651_10309365 3300025960 Bacteria 1317
87 Ga0207640_10195732 3300025981 Bacteria 1527
88 Ga0207677_10412572 3300026023 Bacteria 1148
89 Ga0207678_10180932 3300026067 Bacteria 1800
90 Ga0207676_10237385 3300026095 Bacteria 1633
91 Ga0207674_10318565 3300026116 Bacteria 1504
92 Ga0207675_100133965 3300026118 Bacteria 2350
93 Ga0207683_10036163 3300026121 Bacteria 4298
94 Ga0207683_10200254 3300026121 Bacteria 1815
95 Ga0268266_10433531 3300028379 Bacteria 1247
96 Ga0307405_10062345 3300031731 Bacteria 2361
97 Ga0373931_0071697 3300035691 Bacteria 1893
98 Ga0439435_0019345 3300042436 Bacteria 1744
99 Ga0451576_0250876 3300045051 Bacteria 1850
100 Ga0495586_0280281 3300046535 Bacteria 954
101 Ga0496100_0357873 3300048903 Unclassified 1104
102 Ga0496101_0123640 3300048904 Unclassified 1959
103 Ga0496102_0013426 3300048905 Bacteria 7094
104 Ga0496102_0293212 3300048905 Bacteria 1533
105 Ga0496104_0796838 3300048907 Bacteria 851
106 Ga0496106_0181536 3300048909 Bacteria 1671
107 Ga0496106_0325792 3300048909 Bacteria 1233
108 Ga0496107_0143091 3300048910 Bacteria 1768
109 Ga0496112_0031148 3300048915 Bacteria 5170
110 Ga0496112_0074558 3300048915 Bacteria 3355
111 Ga0501031_0261160 3300049568 Bacteria 1125
112 Ga0501039_0230425 3300049575 Bacteria 1456
113 Ga0501040_0124657 3300049576 Bacteria 1809
114 Ga0501042_0141600 3300049578 Bacteria 1734
115 Ga0501047_0144464 3300049581 Bacteria 2257
116 Ga0501047_0240322 3300049581 Bacteria 1662
117 Ga0501071_0008910 3300049587 Bacteria 6656
118 Ga0501072_0031404 3300049588 Bacteria 4158
119 Ga0501075_0054350 3300049591 Bacteria 3012
120 Ga0501076_0011714 3300049592 Bacteria 6546
121 Ga0501076_0029795 3300049592 Bacteria 4246
122 Ga0501079_0030315 3300049741 Bacteria 4156
123 Ga0501080_0090131 3300049742 Bacteria 2849
124 Ga0501083_0316863 3300049744 Bacteria 1014
125 Ga0501083_0388089 3300049744 Bacteria 908
126 Ga0501045_0173879 3300049824 Bacteria 1604
127 nmdc:mga05p37_10317_c1 3300050507 Bacteria 11093
128 nmdc:mga05p37_1065810_c1 3300050507 Bacteria 851
129 nmdc:mga05p37_33448_c1 3300050507 Bacteria 6296
130 nmdc:mga05p37_41403_c1 3300050507 Bacteria 5656
131 nmdc:mga05p37_593354_c1 3300050507 Bacteria 1252
132 nmdc:mga05p37_72164_c1 3300050507 Bacteria 4248
133 nmdc:mga05p37_8538_c1 3300050507 Bacteria 12107
134 nmdc:mga05p37_885076_c1 3300050507 Bacteria 965
135 nmdc:mga09592_655868_c1 3300050508 Bacteria 896
136 nmdc:mga06r32_308666_c1 3300050510 Bacteria 1567
137 nmdc:mga08y16_36923_c1 3300050511 Bacteria 5131
138 nmdc:mga08y16_373394_c1 3300050511 Unclassified 1463
139 nmdc:mga0n895_400751_c1 3300050512 Bacteria 1388
140 nmdc:mga0n895_67297_c1 3300050512 Bacteria 3547
141 nmdc:mga0n895_80734_c1 3300050512 Bacteria 3241
142 nmdc:mga0n895_84425_c1 3300050512 Bacteria 3168
143 nmdc:mga0rr50_335591_c1 3300050513 Bacteria 1270
144 nmdc:mga0rr50_466920_c1 3300050513 Unclassified 1071
145 nmdc:mga0rr50_4992_c1 3300050513 Bacteria 7859
146 nmdc:mga0rr50_558319_c1 3300050513 Bacteria 975
147 nmdc:mga0rr50_64570_c1 3300050513 Bacteria 2770
148 nmdc:mga08x19_173642_c1 3300050514 Bacteria 1469
149 nmdc:mga08x19_41801_c1 3300050514 Bacteria 2920
150 nmdc:mga0a205_118477_c1 3300050515 Bacteria 2546
151 nmdc:mga0a205_331375_c1 3300050515 Bacteria 1392
152 nmdc:mga0a205_546470_c1 3300050515 Bacteria 1014
153 Ga0501084_0041957 3300054114 Bacteria 3826
154 Ga0501082_0209550 3300060353 Bacteria 1696
155 Ga0501082_0312777 3300060353 Bacteria 1368
156 Ga0530510_0243714 3300061734 Bacteria 1338
157 Ga0070660_100246339
158 Ga0065715_10241350
159 Ga0070676_10174410
160 Ga0070690_100031503
161 Ga0070670_100086730
162 Ga0070670_100289109
163 Ga0070666_10214126
164 Ga0070661_100157625
165 Ga0070669_100171286
166 Ga0070671_100095836
167 Ga0070708_100039987
168 Ga0070708_100062773
169 Ga0070663_100245539
170 Ga0070678_100079712
171 Ga0070662_100446668
172 Ga0070681_10229882
173 Ga0070706_100721580
174 Ga0070698_100436302
175 Ga0070699_100010613
176 Ga0070699_100207165
177 Ga0070679_100416274
178 Ga0070686_100000572
179 Ga0070695_100631490
180 Ga0070665_100225183
181 Ga0070665_100707285
182 Ga0070704_100236514
183 Ga0068855_100116988
184 Ga0068854_100157525
185 Ga0068859_100214039
186 Ga0068859_100652803
187 Ga0068864_100181270
188 Ga0068861_100021144
189 Ga0068860_101063155
190 Ga0081455_10295283
191 Ga0068871_100686230
192 Ga0075430_100130400
193 Ga0075431_100156684
194 Ga0075433_10011258
195 Ga0075433_10045183
196 Ga0075433_10293478
197 Ga0075434_100013055
198 Ga0075434_100020443
199 Ga0075434_100089533
200 Ga0075434_100192353
201 Ga0075429_100175095
202 Ga0075429_100214034
203 Ga0075429_100712756
204 Ga0075436_100019234
205 Ga0097620_100214039
206 Ga0097620_100652752
207 Ga0075435_100000546
208 Ga0075435_100000822
209 Ga0105240_10269931
210 Ga0105240_10287097
211 Ga0114129_10001166
212 Ga0114129_10001945
213 Ga0114129_10008216
214 Ga0114129_10043832
215 Ga0114129_10114406
216 Ga0114129_10255813
217 Ga0114129_10781026
218 Ga0105241_10082561
219 Ga0105248_10021862
220 Ga0105248_10215294
221 Ga0105238_10127203
222 Ga0105249_10004760
223 Ga0157378_10002303
224 Ga0157376_10564810
225 Ga0207680_10092016
226 Ga0207684_10609762
227 Ga0207707_10155071
228 Ga0207695_10082025
229 Ga0207695_10445953
230 Ga0207662_10024343
231 Ga0207657_10211435
232 Ga0207646_10423552
233 Ga0207650_10262336
234 Ga0207644_10071053
235 Ga0207706_10093569
236 Ga0207704_10094609
237 Ga0207711_10036691
238 Ga0207711_10096273
239 Ga0207711_10608242
240 Ga0207711_10666736
241 Ga0207651_10017455
242 Ga0207651_10309365
243 Ga0207640_10195732
244 Ga0207677_10412572
245 Ga0207678_10180932
246 Ga0207676_10237385
247 Ga0207674_10318565
248 Ga0207675_100133965
249 Ga0207683_10036163
250 Ga0207683_10200254
251 Ga0268266_10433531
252 Ga0307405_10062345
253 Ga0373931_0071697
254 Ga0439435_0019345
255 Ga0451576_0250876
256 Ga0495586_0280281
257 Ga0496100_0357873
258 Ga0496101_0123640
259 Ga0496102_0013426
260 Ga0496102_0293212
261 Ga0496104_0796838
262 Ga0496106_0181536
263 Ga0496106_0325792
264 Ga0496107_0143091
265 Ga0496112_0031148
266 Ga0496112_0074558
267 Ga0501031_0261160
268 Ga0501039_0230425
269 Ga0501040_0124657
270 Ga0501042_0141600
271 Ga0501047_0144464
272 Ga0501047_0240322
273 Ga0501071_0008910
274 Ga0501072_0031404
275 Ga0501075_0054350
276 Ga0501076_0011714
277 Ga0501076_0029795
278 Ga0501079_0030315
279 Ga0501080_0090131
280 Ga0501083_0316863
281 Ga0501083_0388089
282 Ga0501045_0173879
283 nmdc:mga05p37_10317_c1
284 nmdc:mga05p37_1065810_c1
285 nmdc:mga05p37_33448_c1
286 nmdc:mga05p37_41403_c1
287 nmdc:mga05p37_593354_c1
288 nmdc:mga05p37_72164_c1
289 nmdc:mga05p37_8538_c1
290 nmdc:mga05p37_885076_c1
291 nmdc:mga09592_655868_c1
292 nmdc:mga06r32_308666_c1
293 nmdc:mga08y16_36923_c1
294 nmdc:mga08y16_373394_c1
295 nmdc:mga0n895_400751_c1
296 nmdc:mga0n895_67297_c1
297 nmdc:mga0n895_80734_c1
298 nmdc:mga0n895_84425_c1
299 nmdc:mga0rr50_335591_c1
300 nmdc:mga0rr50_466920_c1
301 nmdc:mga0rr50_4992_c1
302 nmdc:mga0rr50_558319_c1
303 nmdc:mga0rr50_64570_c1
304 nmdc:mga08x19_173642_c1
305 nmdc:mga08x19_41801_c1
306 nmdc:mga0a205_118477_c1
307 nmdc:mga0a205_331375_c1
308 nmdc:mga0a205_546470_c1
309 Ga0501084_0041957
310 Ga0501082_0209550
311 Ga0501082_0312777
312 Ga0530510_0243714

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03167

UDG

Uracil DNA glycosylase superfamily

106

252

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zbz-assembly1.cif.gz_A family 4 uracil-dna glycosylase from sulfolobus tokodaii (free form, x-ray wavelength=1.5418) 0.7801 61 241
1vk2-assembly1.cif.gz_A crystal structure of uracil-dna glycosylase (tm0511) from thermotoga maritima at 1.90 a resolution 0.7691 56 237
1ui1-assembly1.cif.gz_A crystal structure of uracil-dna glycosylase from thermus thermophilus hb8 0.7599 61 241
1vk2-assembly1.cif.gz_A crystal structure of uracil-dna glycosylase (tm0511) from thermotoga maritima at 1.90 a resolution 0.7384 56 237
6iod-assembly2.cif.gz_B the structure of udgx in complex with single-stranded dna 0.7379 61 236
ID Description Score Start End Superfamily
4zbzA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.78 61 241 3.40.470.10
1ui0A00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.755 61 241 3.40.470.10
4zbzA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.7364 61 241 3.40.470.10
af_Q9V4D8_761_956_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.7306 138 239 3.40.470.10
1ui0A00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.7138 61 241 3.40.470.10
ID Description Score Start End GO Terms
AF-A0A3B8HFR3-F1-model_v4 Uracil-DNA glycosylase 0.9463 159 239 GO:0006281
GO:0046872
GO:0051539
GO:0097506
AF-A0A6J4KR73-F1-model_v4 Uracil-DNA glycosylase, family 4 (EC 3.2.2.27) 0.9174 153 239 GO:0004844
GO:0006281
GO:0046872
GO:0051539
AF-A0A2H5VPH1-F1-model_v4 Uracil-DNA glycosylase-like domain-containing protein 0.917 143 238 GO:0006281
GO:0046872
GO:0051539
GO:0097506
AF-A0A2V8ET64-F1-model_v4 Uracil-DNA glycosylase-like domain-containing protein 0.9167 143 241 GO:0006281
GO:0046872
GO:0051539
GO:0097506
AF-A0A836RLM8-F1-model_v4 Uracil-DNA glycosylase 0.9085 138 242 GO:0006281
GO:0046872
GO:0051539
GO:0097506

Map